SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013191 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013191
Domain Number 1 Region: 1350-1589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.79e-71
Family ABC transporter ATPase domain-like 0.0000241
Further Details:      
 
Domain Number 2 Region: 1022-1336
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 3.14e-51
Family ABC transporter transmembrane region 0.0039
Further Details:      
 
Domain Number 3 Region: 677-935
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.65e-48
Family ABC transporter ATPase domain-like 0.000045
Further Details:      
 
Domain Number 4 Region: 284-610
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 8.5e-37
Family ABC transporter transmembrane region 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013191   Gene: ENSONIG00000010493   Transcript: ENSONIT00000013201
Sequence length 1594
Comment pep:known_by_projection scaffold:Orenil1.0:GL831185.1:3698978:3755697:1 gene:ENSONIG00000010493 transcript:ENSONIT00000013201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAFCGNENNSMAYNVDRGVLNNGCFLDALNVVPHVFVLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWLLTFILLFILVCEIAEGIVSDGFSQSLHLHLYMPAALAFMAGITS
IVYYHNIETSNFPKLLLALLIYWVLAFIMKTIKFAKYTEHGIGPRQLRYCITGLLVLLYG
LLLTVEINVILGRRYMCFANPTEVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTFITSA
HKRPIDLKVIGKLPIAMRALTNYIKLRKAFEDQKRPQGIAPQGPKWIWQALRKAFGRPLI
LSITFRFLADLLGFAGPLCISGIVHHISKDNRTIQPPIKLLGIYFISSKEFLENAYVLAV
LLFFALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMRLCTSTMSMGELTVGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIVVGVILLYYLLGISALIGATVIAVLAPVQYFVATK
LSQTQKSTLEYSSERLKKTNELLRGIKLLKLYAWERIFCDSVEETRVKELTSLQAFALYT
SISIFMNAAIPIAAVLTTFVVHVHISEDADLSPAVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFFSSDEIGDEQEPKATLPTGSSNHNQNRYQAVPLKVVNRKRPSRDDWN
NYGSEGNHEGDGPFQDVDQDICIKISNGYFTWVDGAPTLSNVDIKIPFGKLTMIVGQVGC
GKSSLLLAALGEMQRVSGTVTWNSIYSLPNLESEGDESSPTDKDAAGDGDIRKRGPVAYA
SQKAWLLNATVVENITFEMPMIKSRYKAVIEACSLQPDIDILPQGDQTEIGERGIILSGG
QKQRISVARALYQQTNVVFLDDPFSALDIHLSDHLMQDGILKLLREEKRTVVLVTHKLQY
LPHADWIIAMKDGTIQTEGTLKDIQNSEPELFEQWKTLMNRQDQEFEKETVAESMTDIER
KNLRRAMYSREAARTEEDEEVSTPEESVESEDDDNLSQVMRQRATIPWRSCGTYLSSAGL
LLLSLLLLSQLLKHSLMVAIDYWLAHWTSHVIAAKKDASAHNCTVVQDCGFSHSWYLSVF
SVLCCLGIVLCLATSVAVEWTGLKAAKELHHNLLNKIILAPMRLFETTPLGSILNRFSTD
TNTIDQHIPTTLECLSRSTLLCVSALGVISYVTPVFLIALLPLAVTCYFIQKYFRMASRD
LQQLEDSTQLPLLSHFSETVEGLTTIRALRYEPRFRQRLLQFTDANNIASLFLTAANRWL
EVRMEYIGACVVLVAAVASITNSLYDQLSPGLVGLGLTYALMVSNYMNWMVRNLADMEVQ
LGSVKRINGLLKTEPENYEGLLTVSQVPDGWPRQGEIKIQNLSVRYDATLKPVLKNVNAH
INPGQKVGICGRTGSGKSSFSLAFFRMVDMFEGRIVIDNIDISKLPLQTLRSRLSIILQD
PILFSGTIRFNLDPEMKATDEMLWEALEIAQLKPVVKSLPGGLDAIVTEGGENFSQGQRQ
LFCLARAFVRKSSILIMDEATASIDMATESILQKVVMTAFADRTVVIIAHRVHTILNADL
VIVMKRGIILEYDRPQALLDKEDSVFASFVQADK
Download sequence
Identical sequences I3JWE6
ENSONIP00000013191 ENSONIP00000013191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]