SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013470 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013470
Domain Number 1 Region: 1839-2013
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.15e-60
Family Sec63 N-terminal domain 0.0000000259
Further Details:      
 
Domain Number 2 Region: 1209-1503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.21e-56
Family Tandem AAA-ATPase domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1008-1180
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 3.4e-54
Family Sec63 N-terminal domain 0.00046
Further Details:      
 
Domain Number 4 Region: 674-886
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.33e-48
Family Tandem AAA-ATPase domain 0.00089
Further Details:      
 
Domain Number 5 Region: 417-664
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-45
Family Tandem AAA-ATPase domain 0.00023
Further Details:      
 
Domain Number 6 Region: 1512-1721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-42
Family Tandem AAA-ATPase domain 0.0024
Further Details:      
 
Domain Number 7 Region: 2014-2126
Classification Level Classification E-value
Superfamily E set domains 2.52e-32
Family Sec63 C-terminal domain-like 0.00000141
Further Details:      
 
Domain Number 8 Region: 886-991
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000843
Family Restriction endonuclease FokI, N-terminal (recognition) domain 0.079
Further Details:      
 
Domain Number 9 Region: 1721-1822
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000171
Family RecQ helicase DNA-binding domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013470   Gene: ENSONIG00000010714   Transcript: ENSONIT00000013480
Sequence length 2136
Comment pep:known_by_projection scaffold:Orenil1.0:GL831172.1:842850:856462:-1 gene:ENSONIG00000010714 transcript:ENSONIT00000013480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKAQRTK
PQRLEERREKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEVLLSFI
HAALGDQPRDILCGAADEVLAVLKNDKMRDKERRREVEQLLGPADDTRYHVLVNLGKKIT
DYGGDKDLQNMDDNIDETYGVNVQFESDEEEVDEDQYGEVRDEHSDEDSEGVEAAVDSTL
SANLGGAGDVMTVKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKILRQHRRMIQYCTMLASAQSEAEKERIIGKMESDQELSKIL
YQLQETEKEDIIREERSRRERVRKSRVDDLEAMDIDHGESVTPRQLLDLDDLAFSQGSHF
MANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFAEDEVLVPIEKLPKYAQAGFEGFKTLN
RIQSKLFKTTMETDENLLVCAPTGAGKTNVALMAMLREIGKHINIDGTINVDDFKIIYIA
PMRSLVQEMVGSFSKRLASYGIIVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGE
RTYTQLVRLIIIDEIHLLHDDRGPVLESLVARTIRNVELTQEDVRLLGLSATLPNYEDVA
TCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVL
VFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGF
AIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWT
ELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVGKLADMLN
AEIVLGNVQNVKDAVNWLGYTYLYVRMLRNPTLYGVSHDDRSTDPLLERRRMDLVHTAAN
ILDKNSLIKYDKRTGSFQVTDLGRIASHFYITHDSVQTYNQLLKPTLSEIELFRVFSLSS
EFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMV
YVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDKRMWQSMSPLRQFKKLPEEVIKK
IEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHVQPITRSTLKVEL
TVTPDFQWDDKIHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPL
PPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVTALRNSAFEALYQ
NKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNAEGRCVYITPM
EALAEQVFIDWHQKFQDILDKKVVLLTGETSTDLKLLGKGDIIISTPDKWDILSRRWKQR
KNVQNVSLFIVDETHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAH
WLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMKHSPSKPAVVF
VPSRRQTRLTAIDVLTFCAADVVPQRFLHCAEKDLAPFLEKINDSTLKETLANGVGYLHE
GLSATERRIVEQLFNSGAVQVVVSSRSLCWGINISAHLVIVMDTQYYNGKIHAYVDYPIY
DVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVT
KTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLHDLEQSKCI
SIEDELDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRH
HEDALLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRL
IQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPFFTSEHIKRCTEKGVESI
FDIMEMEDEDRSALLQLSDSQMADVARFCNRYPNIELSYEVAEKDSVKSGSPVLVQVQLE
REEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAPAMGIH
NYTLYFMSDAYMGCDQEYKFGIDVKEADSDGDSDSD
Download sequence
Identical sequences I3JX75
XP_003445732.1.78416 XP_019221168.1.78416 ENSONIP00000013470 ENSONIP00000013470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]