SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013645 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013645
Domain Number 1 Region: 18-759
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-264
Family Motor proteins 0.0000000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013645   Gene: ENSONIG00000010849   Transcript: ENSONIT00000013655
Sequence length 1036
Comment pep:known_by_projection scaffold:Orenil1.0:GL831338.1:896174:915621:-1 gene:ENSONIG00000010849 transcript:ENSONIT00000013655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASDGVRAMMESALTARDRVGVQDFVLLENYTSEAAFIENLRKRFKENLIYTYIGSVLVS
VNPYKDLEIYTKNHMERYRGVNFYEVSPHIYAVADNSYRSMRTEGKDQCILISGESGAGK
TEASKKILQYYAVTCPASEQVQTVKDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDIQF
DFKGAPVGGHIINYLLEKSRVVHQNHGERNFHIFYQLIEGGEEDLLRHLGLERNPQQYQY
LIKGNCPKVSSINDRSDWKVVRKALTVIGFSENEVEELLNIIASVLHLGNVQYGGEDSNA
CITSDIQIKYLARLLGVNVTALTEALTHKKIIAKGEELMSPLNLEQASSARDALAKAVYG
RTFTWLVNKINTSLTYTQGDSSKNYSVIGLLDIYGFEVFQHNSFEQFCINYCNEKLQQLF
IELTLKSEQDEYEAEGITWEPVQYFNNKIICDLVEEKFKGIISILDEECLRPGDASDLTF
LEKLEDTVGGHPHFVTHKLADAKTRKVMGRDEFRLLHYAGEVKLTFSSSRFLDKNNDLLF
RNLKEVMCMSENKILTQCFNREELSDKKRPDTAATQFKASLAKLMEILMSKEPSYVRCIK
PNDSKQSGRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRRYEVFLQRYKSLCPGTWPNWD
GKLSDGVSTLVKHLGYKPEEYKMGRSKIFIRFPKTLFATEDALETRKHSLATKLQAGWKG
YSQKCKYQKLRNSAIAVQAWWRGILARRRAQHRRQAANTIRRFIKGFIYRHKERCPENEY
FLDYVRYSFLMNLRKNLPKNVLDKSWPTPPAALTEASEHLRKMCMQNMVWSYCKKINPEW
KHQMEQKMIASEIFKDKKDNYPQSVPKLFVSTRLDGENINPKVVQALGSEKMKYAVPVTK
YDRRGYKPRHRQLLLTANSAVIAEEGKLKQRIDYGTLKGISVSSLSDGVFVLHVPSEDNK
QKGDVVLQSDHVIETLTKLAICADKINSININQGSIKFTMGQGKEGIIDFTPGSELLVAK
AKNGHLSVTAPRLNSR
Download sequence
Identical sequences I3JXQ0
ENSONIP00000013645 ENSONIP00000013645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]