SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013757 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013757
Domain Number 1 Region: 64-259
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.05e-27
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 375-417
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000222
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013757   Gene: ENSONIG00000010935   Transcript: ENSONIT00000013767
Sequence length 436
Comment pep:known_by_projection scaffold:Orenil1.0:GL831172.1:2083043:2092011:-1 gene:ENSONIG00000010935 transcript:ENSONIT00000013767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLHGFRRIIYEYQPLVDAVMCVIGLEERDDIGEERSSEEESAISRSLVELLEQESQSE
VFVEGISYALFKMAERGLVQPAKILLRYGADLNFEDPVSYYNPLHIAVLRNRPNMVKLLA
GHGADIEKRDRIHESSPLDLASEESERLPCLLALLDLGADVNARDKHGKTPLLHALASSD
GITVHNTENIQLLLERGADVRAATVDGETVESSLVFLVKEALEASVEDAAQIGNFCLKTT
QLLLAHGVDPSCCLNEDGEPSLTQTSLEYFDLLFPLAVLLIQSGASLVCSNHSDSCWSGY
SLLFQRLQTALQQCSDQTHAAELLEQAEMLLDLVKVHSPTLHLSCGLQLPMPGQESHPYA
QALLDLHKHVAEREASPPALRCLCRVFIRDRLKPWPLEDRVKALPLPDRLKYFLLPEHTY
TPKSGWDCFKPQQSQR
Download sequence
Identical sequences I3JY12
ENSONIP00000013757 ENSONIP00000013757 XP_003445679.1.78416 XP_005473148.1.78416 XP_005473149.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]