SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014020 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014020
Domain Number 1 Region: 74-200
Classification Level Classification E-value
Superfamily Bromodomain 6.02e-31
Family Bromodomain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014020   Gene: ENSONIG00000011135   Transcript: ENSONIT00000014030
Sequence length 270
Comment pep:known_by_projection scaffold:Orenil1.0:GL831211.1:1006383:1014444:1 gene:ENSONIG00000011135 transcript:ENSONIT00000014030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLAARRYAGLLILSPTAAADPDSQPADCSQLEARENGSLEDMEEDISLKKRKGDHQAV
KDLKAGQETGEKVKRKRGRPPAEKLPPNPPELTRTLNTLVDMVMNYKDGLGRQISKGFVQ
LPSKKEVPEYYELIRKPVDFRRIRERVRNHKYRSVGDLEKDIFLLCHNAQTYNLEGSQIY
EDSIVIKSVFESARQRIVTDEEQKETVSASHSNNGGGAEDQFLPSAVKPLPVQIKKGAKE
QRSRNTMAKRVHSDLDSDEDLEDNTTKDEG
Download sequence
Identical sequences I3JYS5
ENSONIP00000014020 ENSONIP00000014020 XP_003449674.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]