SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014034 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014034
Domain Number 1 Region: 58-836
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-287
Family Motor proteins 7.41e-17
Further Details:      
 
Domain Number 2 Region: 1233-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.68e-28
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number 3 Region: 837-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.66e-25
Family Myosin rod fragments 0.00000274
Further Details:      
 
Domain Number 4 Region: 960-1070
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.32e-24
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 5 Region: 1428-1550
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000471
Family Myosin rod fragments 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014034
Domain Number - Region: 1627-1743
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000128
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1067-1181
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000392
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 1806-1922
Classification Level Classification E-value
Superfamily Tropomyosin 0.000399
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 1350-1429
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 1568-1628
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014034   Gene: ENSONIG00000011145   Transcript: ENSONIT00000014044
Sequence length 1934
Comment pep:known_by_projection scaffold:Orenil1.0:GL831139.1:6384688:6395143:-1 gene:ENSONIG00000011145 transcript:ENSONIT00000014044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDAEMAVYGKAAIYLRKPEKERIEAQNKPFDAKSACYVADAKELYLKGTIIKKDGGKV
TVKVLDTQEERTVKEEDVSPMNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYS
GLFCATVNPYKWLPVYDSEVVAAYRGKKRMEAPPHIFSVSDNAYQFMLTDRENQSVLITG
ESGAGKTVNTKRVIQYFATISVGGDKKKDSGKMQGSLEDQIIAANPLLEAYGNAKTVRND
NSSRFGKFIRIHFGQTGKLASADIETYLLEKSRVTFQLPDERGYHIFYQMMTNHKPELIE
MALITTNPYDFPMCSMGQITVASIDDKVELEATDNAIDILGFSNEEKMSIYKMTGAVLHH
GNMKFKQKQREEQAEPDGTEDADKVAYLLGLNSADMLKALCYPRVKVGNEYVTKGQTVPQ
VLNSVTALAKSIYEKMFLWMVIRINQMLDTKQQRNFFIGVLDIAGFEIFDFNTLEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIVWEFIDFGMDLAACIELIEKPMGIFSILEEECM
FPKATDTSFKNKLYDQHLGKCKAFEKPKPAKGKAEAHFSLVHYAGTVDYNISGWLDKNKD
PLNESVLQLYQKSSVKLLGHLYPPVVEEAGGAKKGGKKKGGSMQTVSSQFRENLGKLMTN
LRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQR
YKVLNASVIPEGQFIDNKKAAEKLLGSIDIDHDQYRFGHTKVFFKAGLLGTLEEMRDEKL
AALVTMTQAVCRGFLMRKEFVKMMERRESIFTIQYNIRSFMNVKHWPWMKVYYKIKPLLK
SAETEKELQQMKENYEKMKTDLATALAKKKEIEEKMVSLLQEKNDLQLQVASESENLSDA
EERCEGLIKSKIQLEAKLKEVTERLEDEEEINAELTGKKRKLEDECSELKKDIDDLELTL
AKVEKEKHATENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLT
KSKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDEKLK
KKDFETSQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSR
ELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAAALRKKQADSVA
ELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKGNLEKMCRTLEDQLSELKA
KNDENVRQINDLGAQKARLLTENGEFSRQIEEKEALVSQLTRGKQAFTQQIEELKRHTEE
EIKAKNALAHALQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQ
RTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQSEVEDLMIDVERANGLAAN
LDKKQRNFDKVLAEWKQKYEEGQAEVEGAQKEARSLSTELFKMKNSYEEALDQLETMKRE
NKNLQQEISDLTEQIGETGKSIHELEKSKKQVETEKAEIQTALEEAEGTLEHEESKILRV
QLELNQVKGEVDRKLAEKDEEIEQIKRNSQRVIDSMQSTLDSEVRSRNDALRIKKKMEGD
LNEMEIQLSHANRQAAESQKQLRNVQAQLKDAQLHLDDAVRSQDDLKEQAAMVERRNGLM
VAEIEELRAALEQTERSRKIAEQELVDASERVGLLHSQNTSLLNTKKKLEADLVQIQSEV
EDTVQEARNAEEKAKKAITDAAVMAEELKKEQDTSAHLERMKKNLEAAVKDLQHRLDEAE
NLAMKGGKKQLQKLESRVRELEAEVEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNI
NRLQDLVDKLQLKVKAYKRQAEEAEEQANVHLSKYRKLQHELEEAEERADIAESQVNKLR
AKSRDSGKGKDAAE
Download sequence
Identical sequences I3JYT9
ENSONIP00000014034 ENSONIP00000014034 XP_003439494.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]