SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014105 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014105
Domain Number 1 Region: 641-820
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.4e-47
Family ATP-dependent protease Lon (La), catalytic domain 0.00000557
Further Details:      
 
Domain Number 2 Region: 326-579
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-46
Family Extended AAA-ATPase domain 0.004
Further Details:      
 
Domain Number 3 Region: 12-224
Classification Level Classification E-value
Superfamily PUA domain-like 7.7e-17
Family LON domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014105   Gene: ENSONIG00000011208   Transcript: ENSONIT00000014115
Sequence length 842
Comment pep:known_by_projection scaffold:Orenil1.0:GL831139.1:6689236:6705885:1 gene:ENSONIG00000011208 transcript:ENSONIT00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSGAIQIPSRLPLLLTHEGVLLPGSTVRFSVDSPRNMHLVRERLLKGTSLKSTIIGVI
PNTRDPEHDTDDLPTLHKIGTAGIAVQVVGSNWPKPHYTLLITGLCRFSVSSLLKERPFV
LAEVKQLDQLERYTTPQRDATATDDGELGELSEKFYQAAVQLLGMLDMSVPVVAKFRRLL
DSLPRETLPDVVASMIRTSNKEKLQVLDALSLEERFKKALPMLTRQIEGLKLLQKTRKMS
PDNEKRVLVRKGTVFPGRQFNLDEEDEDDDGDDTAALERKVHGANMPEAALKICLKELKR
LKKMPQSMPEYALTRNYLDLMVELPWSKSTKDCLDIRAARTLLDNDHYAMDKLKRRVLEY
LAVRQLKTSLKGPILCFVGPPGVGKTSVGRSIARTLGREFHRIALGGVCDQSDIRGHRRT
YVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHSFTDHYL
NVAFDLSQVLFIATANTTATIPPALLDRMEVLEVPGYTQEEKVEIAHRHLIPNQLEQHGL
TPQQLHIPQSTTPDIISRYTREAGVRSLERKIGAICRAVAVKVAEGHTLTKTETLTPENS
KQHGDKAAPPELPIVIDHIALKDILGPPVFEMEVSERLTLPGVALGLAWTPLGGEIMFVE
ASRMEGEGQLTLTGQLGDVMKESAHLAISWLRANAKTYQLTNMVGGSDPLEGTDIHLHFP
AGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRA
GVKRVILPKRNEKDLEELPANVRANLDFITATNLGEVLNASFDGGFPGVSGTRAHPQLTS
KL
Download sequence
Identical sequences I3JZ10
ENSONIP00000014105 XP_005449468.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]