SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014233 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014233
Domain Number 1 Region: 633-809
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-45
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 425-625
Classification Level Classification E-value
Superfamily RNI-like 1.04e-30
Family 28-residue LRR 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014233
Domain Number - Region: 78-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0151
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014233   Gene: ENSONIG00000011307   Transcript: ENSONIT00000014243
Sequence length 815
Comment pep:novel scaffold:Orenil1.0:GL831382.1:191326:213761:1 gene:ENSONIG00000011307 transcript:ENSONIT00000014243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSTLKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTAEVNDEHEVRQIETASRKPDGP
ETTIRQEDIFKGSPGRDEPIRTVLTKGVAGIGKTVLTQKYTLDWAEDKANQDIQFIFPFT
FKELNVLKEEKFSLVELVHHFFTETKEAGICSFEDFQVVFIFDGLDECRLPLDFHKATIL
TDPRKSTSVDVLLTNLIRGKLLPSARLWITTRPAAASQIPPDCVDILTEVRGFTDPQKEE
YFRKRFSDEEQASRIISHIKTSRSLHIMCHIPVFCWITATVLEDVLKTREGGQLPKTLTE
MSIHFLVVQAKVKKAKYDGGAETDPPWSPESRKMIESLGKLAFDQLQKGNLMFYESNLTE
CGIDIRAASDGHLDLFLRFLLGLSLQTNQTLLRGLLTQTESNSWINQKTLQYIKKKLSEK
LSAEKTINLFHCLNELNDCSLVEEIQQSLSSGSLSTDKLSPAQCSALVFILLSSEKDLDV
FDLKKFSASEEALLRLLPVVKVSNKALLSVCNLSETSCEALSSVLSSQSSSLRELDASNN
NLQDSGVKLLSVGLQSPHCTLETLSLSGCLITEEGCTSLATALSSNPSYLRELDLSYNHP
GNSGMKLLSAGRKAPRWRLDILRVEPAGVRWLRPGLRKYSCQLTIDTNTVNKNLKVSDNN
RKVTHAEEVQSYPDHPDRFDVYEQLLCRDGLTGRCYWEVEWTGDVEISVSSRKIRRKGDS
TDCLFGWNDQSWSLICSDDRPRSVRQNKTEKSITSSSYSICNRVAVYVNCPAGTLSFYRV
SSDTLIHLHTVNTTFTETLYPGFWFRSPGSSVCLC
Download sequence
Identical sequences I3JZD8
ENSONIP00000014233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]