SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014332 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014332
Domain Number 1 Region: 1414-1526
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-34
Family Bromodomain 0.00018
Further Details:      
 
Domain Number 2 Region: 1136-1200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.31e-17
Family PHD domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014332
Domain Number - Region: 1189-1248
Classification Level Classification E-value
Superfamily ARM repeat 0.042
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014332   Gene: ENSONIG00000011387   Transcript: ENSONIT00000014343
Sequence length 1543
Comment pep:known_by_projection scaffold:Orenil1.0:GL831417.1:667213:702896:1 gene:ENSONIG00000011387 transcript:ENSONIT00000014343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLHRKPFIRQKPPADLRPDEEVFLCKITHEIFRTYDEFFERTILCNSLVWSCALTGRA
GLTYLEAVESERRARQSLESFPQSLVVPLLHLAALSQCCRLTELCEDVYTFVKDRFFPGE
VVDVSGCNGARYVCEILQVHLPDSSVSRAPDVNGHGKMADDDTIVISDSDDEHNAFQSST
VQVNGRKKSLSPSVFKYTVRMMKNKHSEPFTVTANQISRKKSALSRERLKLLFKQHCEPQ
NGIVTLKPSSMAKYQLSKQTFSQFFPDEPPLFSFSPSSKCGRRDSPGQKIHKFLVNNYFL
RQKASSSLLKAAEEKLKLLQQREEMVAAAQDKARLKKEKEEVQEAKRREREDKERLREEQ
RRRFEEEKQRRREEKERRKLEKDREREKLKEEKKKYAEQLKLWSKPREDMDCEDLKELPR
PIPVKTRLPAELFGDALMVLEFLQAFGEAFDLKDEFPDGVSLEVLEEALVGSDPEGPLCE
LLFFFLTAIFQALDEEQEEVATDQVEDTRLSDLTDALDDDSDPTCSALSAIASLAAAWPQ
LHQGCTLKQLDLDSCTLSEILRLHILASGADCNHGNAKFRYQKQGGFTVMDDPCVELRLA
DPALLKKLSSTAVYDLTPGEKLRILQALVGKVLTLASSRDLIEDCVEEQRAARHELREIR
AEQHRREREEAAHRVRLRKEEKMREQEQRMRAKEEKMKEQELKGRLQTNGDSVTEHHTEN
EEEQSSKIMKAKGNQKEQQQQTVSDLKPPTSLTAEELGREQEKVRNRHFVRKTGTVITIR
TNRTSPREEKLGKKNREGEVRELQERIQKAAACTCLLPLGRDRLYRRYWLFPSASALFVE
ADYFGLTEDMLQPSPKPDQDTSTIKVEKGLKSAASNPAPLHTCSTPINQSNQWSFYSSLE
EVDQLIEALNPRGHRESSLKEALLQERERLQHLLKSCDRNKYEHTDTDGNHSHLFFYPED
QESSQALPECTAAAESMMEVRLRELLLDIEDRIHQGTLGTLKVMDRQIWRSALEVGNYEL
LTSDGRENTGMNGRVEAMEVDCAHLRARDRLQEVKSDSSAAYGSSGSGTPQVVSSSVRIL
AQALAHIEQGIDRRFLKAPLDGSDCGRVSKTVLERWRESLQSCSSLSQVFVHLSSLERSI
LWSRSILNARCRICRCKGDADNMVLCDSCDRGHHTHCLRPRMKSVPEGEWFCPDCRPKQR
SNRLPSRQRSSIDEEEERDYDDEEEEEEQSEEEEEEESEEESEEEEEEEVVVVLKMNRSG
AFLLNLCSPKKRQTPLPKGKSQQATPKNSITTSGKNTSASNKKESFKPNLETQPTDIYTH
TNMPVHPHTHENIGQEHPMKSLPPPCTLQKPRKKPITPPASDGKIPTRSRSRTAAHVSHE
NVEPNSHINKRNTKTSPAQSESRKRSLTGASSSSSNRRSSGRNQGVHELSACEQLTVELV
RHEDSWPFMKLVSRTQVPDYYDIIKKPIALNTIREKVNNCEYQTAGEYISDVELMFSNCL
QYNPRHTNEAKAGHRLQRFFHAELSRLGLLEHVSALPTKRSRH
Download sequence
Identical sequences I3JZN7
ENSONIP00000014332 ENSONIP00000014332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]