SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014333 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014333
Domain Number 1 Region: 18-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-28
Family G proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014333   Gene: ENSONIG00000011388   Transcript: ENSONIT00000014344
Sequence length 369
Comment pep:known_by_projection scaffold:Orenil1.0:GL831139.1:7918463:7937286:-1 gene:ENSONIG00000011388 transcript:ENSONIT00000014344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANSRYKSRAPQTDDGEEKEYVGFATLPNQLHRKSVKKGFDFTLLVAGESGLGKSTLVN
SLFLTDLHKDRKLLNAEERISQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTACW
RPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLHPVDIEFMKALQDKV
NVVPLIAKADCLTPFEIKKLKERVREEIDKYGIKIYQFPHCDSDEDEEFKQQDKELKEST
PFAVIGSNTVVEARGHRVRGRVYPWGIVEVENPSHCDFVKLRTMLIRTHMHDLKDITSDC
HYENYRAQCIQNMTSKMNADKRVESPNPILPLSTPDIETEKLIKTKDEELRRMQQMLQKM
QQQMHEQEL
Download sequence
Identical sequences I3JZN8
XP_003439525.1.78416 ENSONIP00000014333 ENSONIP00000014333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]