SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014361 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014361
Domain Number 1 Region: 228-809,846-1042
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.78e-142
Family Motor proteins 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014361   Gene: ENSONIG00000011412   Transcript: ENSONIT00000014372
Sequence length 2114
Comment pep:known_by_projection scaffold:Orenil1.0:GL831139.1:8061200:8120181:1 gene:ENSONIG00000011412 transcript:ENSONIT00000014372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSRLKLWEQKIKEENKPIVTTVPPPPLSVLPGGFLKQLVRDSEKETKHKEPEVKEER
PFLLPDQTPPILEAEMSLRAEQFSNNSNNSKPQGRNSAQPDGRSSSQCHIVTPDSGGKPE
TRPEVTPEPPKQKLQQWDKRPEKKSKNMEEHTKKERIEEFGQGKEKEKGMEERQEPEGMQ
AETTVTENARKEVRDVWYEAGTVWYVDKDDFIRATQLKPDEGTPELPEGRVRVQLETDGS
VHDVSEYEVEKCNPPELDLCEDLSDLQSVNECGVLHTLTSRAKANLPLTHAGPNLVNFWP
PLQTHSKTPKSRRGESVWDAPPALAALVKRVYMSMVGTRRDHSVCALGRSGTGKTTACQA
FTHALIKQAGTAGDNMSVERVQAMFTILRSFGCVSSKHSDASSRFAMVFSLDFNHAGQAA
AGHLQTLMLDKWKVCQKIQGESNFLVFSQMLAGLSTEMRIELQLHQLSEFNSFGIVHPTK
VEEKQRASIAFTKLLSAMETLGFSPGEQKAIWHVLAGIYHLGAAGACKVGRRQFMNFDSA
QMASSVLGCEGDDLHTAVFKHHLRQLLQRATGGSRERSGAAESEEGPRLTAAQCLDGMAA
GLYEELFTAIVSLINRALSSQQLMLASVMVVDTPGLRNPRHSAEERGASWSEFCHNYLQE
RLLEHYHSHTFTHTLERYAQEKVHVEFECPETSPAEVVSAIDQPPPQVRAADEDPRGLLW
VLDEEMVTPASCENRAVERVCHYYSDMVRQCEQLMQCEVKHLMGSDPVRYDLAGWFSLIQ
NNPSALNAICLLQNSTVGVVKAMFTPRISLPPLCRALGGLEGGSQRSLQRNGTIRKTFSG
GMAAIRRHSQCIAVKLQADALINLIRRARPVFLQCVSAKTDNGSFDIPALRVQLHSTQIL
SALQLYRIGYSEHMTLGDFRCHFQALAPSVMKRYASVFVSHDERKAVEELLVELDVDKKS
ILVGASRVFMKRGVLCYLEQQREKQVTGWLVHLQAACLGHLARQKYRKLKVQQMAVSCLQ
RNLRALRVVSKWRWWKLFCRLRPLLDVNMDNERLRAKEDEISVLRRRLEKSEKERNELRQ
TADNLETKVTAVTSELSDERFRGDAVGQALDVERAERLRLSRENKDLQARLDQCKVTMET
LEKQLEEEKQKAQATESQRGAVAETELVMQLECCQTEMEFVCRRLKQTEEKLETERQTRQ
ELDAKVATLQAQLEQSRRSVTELKRHCRHLTSDLQDARVLTDSLQSRMHELDRKQRRFDN
KLTQALEEAECEREQKDKAFQENTALGAEIYKLRWSLQESQAEVSRLQKQKEDLCAQIRD
LSLPVDLASESLPALKKQLRLLESQVNEKAEEITKLTAKIQQQQQIHMRFEIEMERMKQI
HQKELEDKDEELEDVHKSSQRRLRQLEMQLEQEYEEKQMVIHEKHDLEGLIATLCDQVGH
RDFDVEKKLRRDLKRTHALLADAQLLLATMESSGQNLPNGSKDQIEHLHFQLEESEARRL
EAESIQATLSQELDNNQAELENICKQKSVVDENLALLQQEKVDLLKRLEEDQEDLNELMK
KHKALIAQSSSDIAQIRELQAELEEVKKQKQSLQEELQQCVSRVQFLESSTVGRSIVSKQ
EARVRDLENKLEFQRGQVKRFEVLVLRLRDSVVRLGEELEQSAQAEARERENARYYQQRV
QDMRLEMEELSQAEQESSRRRMELEMKVEELSTVRQALQADLETSIRRIVDLQAALEEVE
SSDDSDTESVHTAVESFTRKKDLDSVSSVGSVGEEGIHTWSGVSRGGSRSGSSLHSSQGG
RQSVADTISTYSLRSCVNPDDEGSEAGGVASRSLGRAPSSTALSELLEGLRKRRAGGDAG
DETGSTVSLAIYQTTGASTLRRRASALSLSPEDVQEPRPGPSILKPSSPLLPHSTKTPSA
AGGKVSRFNSSDSLSSLPSLPHLSSLAARHHAPSVSIPEEEKSLHSVTTPIQRSPLAPRQ
CMVGSLIPVDVGEGSLGSEPMVFQNRRLPGDRDDAASDVLPAIRRAQSTSSLASSVRGGR
RALSVHFGELPPSSHSRKSSESESSSSGGSGRSSQGGGPRRRFERPQGERLEAEGSEGGD
VALVMKKYLKKETD
Download sequence
Identical sequences I3JZR6
ENSONIP00000014361 ENSONIP00000014361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]