SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014435 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014435
Domain Number 1 Region: 16-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-105
Family Motor proteins 0.00000162
Further Details:      
 
Domain Number 2 Region: 535-617
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.33e-22
Family ComEA-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014435   Gene: ENSONIG00000011470   Transcript: ENSONIT00000014446
Sequence length 620
Comment pep:known_by_projection scaffold:Orenil1.0:GL831456.1:140568:147710:1 gene:ENSONIG00000011470 transcript:ENSONIT00000014446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVAVSDGGNKKTSRVRVAVRLRPYMNKEDEKSEGPCVRGLDSQNLEIINWRNATETV
KYHFDVFHGEQTTQQEVFLSSVKPILPHILNGQNASVFAYGPTGAGKTHTMLGSSEQPGV
IPRAVREVFKLVKAKDESDGWDYSIGMSYLEIYNEKVLDLLSPNSHDLPIREDKDKNILI
PGLTHMNITNFADFDKHFVPATLNRTTASTKLNQRSSRSHAILLIKVVRTQQQLPHRQQT
GKLYLVDLAGSEDNRRTGNQGIRLKESGAINLSLFTLSKVVDSLNSGTSVRVPYRDSKLT
RLLQDSLGGSAHSVMITNIAPEYKYYFDTFSALNFAAKSKLIVNKPFTRETVAVPVLPVK
RSREERETGGSGTEPQKKKHKEEKKSEHDGSSPSTRNHSSSDQSLMGRLIALEKRTMSSQ
DKERLAMLKEIKELKEKQRELESKAMLFSQLAGEKSITGQEPDFENKTTALRRKQSDATK
PNKQQAVVQPLQVSQRQPLQQLLVVKKQSVCVKKKEETCSDLIESLGGKENNTKSAWESQ
LDQSMVDQSKQKILQILNTGCLKELKSLQQIGDKKAKLILGWREIHGHFTKVEDLIQVEG
MTEKRFSSFMKANIVSAMGK
Download sequence
Identical sequences I3JZZ0
XP_003458774.1.78416 XP_005463920.1.78416 XP_005463921.1.78416 XP_019218166.1.78416 ENSONIP00000014435 ENSONIP00000014435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]