SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014462 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014462
Domain Number 1 Region: 21-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-99
Family PAPS sulfotransferase 0.0000000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014462   Gene: ENSONIG00000011490   Transcript: ENSONIT00000014473
Sequence length 309
Comment pep:known_by_projection scaffold:Orenil1.0:GL831456.1:251390:262527:1 gene:ENSONIG00000011490 transcript:ENSONIT00000014473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKDMTYSEAIQKASSSITRFPLIPVRGVPLMNHIANNWDNIWAFRPDPSDLLIATYP
KAGTTWTQEIVDLLLHNGDAEACKRAPTPVRSPFLEIFSPPPIPSGLDLLEKMDPPRVIK
THLPFQLVPPGFWENKCKAIYVARNAKDNLVSYYYFDLMNQTQPEPGPFDGYIHKFMQGE
LSWGSWYDHVKGYWLEREKRNILYLFYEDMKENPRREVERIMRYLDLSVSDEVISQIVEL
TSFKNMKENPMANYSCVPSPVFDQSISPFMRKGEVGDWKNHFTPEQSKLFDEDYEKQMKD
VDIPFRTLI
Download sequence
Identical sequences I3K017
XP_003458778.1.78416 ENSONIP00000014462 ENSONIP00000014462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]