SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014466 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014466
Domain Number 1 Region: 38-64,183-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-64
Family G proteins 0.00000000525
Further Details:      
 
Domain Number 2 Region: 68-189
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.79e-36
Family Transducin (alpha subunit), insertion domain 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014466   Gene: ENSONIG00000011493   Transcript: ENSONIT00000014477
Sequence length 379
Comment pep:known_by_projection scaffold:Orenil1.0:GL831284.1:168912:202129:1 gene:ENSONIG00000011493 transcript:ENSONIT00000014477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNAEEKKQKIHDIKNNIKEAIETIVAAMNTLTPPCQLACPENQSRIDYVLNLV
NQKDFDFPTEFYDHAKILWQDEGVRACWERSNEYQLIDCAQYFLDRIDVVRQNDYTPTDQ
DLLRCRVLTSGIFETRFQIDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNM
VIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEEYFPEF
ARYTTPDDAIPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRV
FNDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3K021
ENSONIP00000014466 ENSONIP00000014466 XP_003454329.1.78416 XP_004547727.1.88231 XP_005929774.1.24487 XP_006782810.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]