SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014537 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014537
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.38e-55
Family G proteins 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014537   Gene: ENSONIG00000011542   Transcript: ENSONIT00000014548
Sequence length 162
Comment pep:novel scaffold:Orenil1.0:GL831167.1:1719622:1721563:-1 gene:ENSONIG00000011542 transcript:ENSONIT00000014548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRLFKVVLVGNSSVGKTSLLRSFCEGRFHPSTTATVGIDYSVKTLTLDNMQVAMQLWDTA
GQERYRSITKQFFRKADGVVVMYDVTVEESFKAVRPWITNVQEAAGEGIPILLLGNKMDM
DEDREVSFKEAEQLAYENKVMFFEVSAYTGKNLTESLTHLAR
Download sequence
Identical sequences I3K092
ENSONIP00000014537 ENSONIP00000014537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]