SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014618 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014618
Domain Number 1 Region: 311-497
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-44
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 24-257
Classification Level Classification E-value
Superfamily L domain-like 1.47e-37
Family Internalin LRR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014618   Gene: ENSONIG00000011607   Transcript: ENSONIT00000014629
Sequence length 586
Comment pep:known_by_projection scaffold:Orenil1.0:GL831167.1:2351844:2361607:-1 gene:ENSONIG00000011607 transcript:ENSONIT00000014629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGVLTAEMISNSIFQLGRFGTGLQHSFYILSLPSHNLSDISVLCSYVHLQKLELPHNKIQ
DLSCVSHMPYLVMLDASYNEISNFFEFQPPKNLKEVNFSHNRMTKMRDLSAYASLTKLDL
DYNSFSEISGLEQCCRLTHLSLAHNKISRISGLGGLPLTHLCLRGNHLEKIEGLEHLKSL
QVLDLSQNRITSLSGLENLHLLGSLNLEKNLVSEIQECKHIHDLLLLRDLSLVENPVQEQ
PDYKLAVIFLLQHLTVLDQEAVTVEEKVSSVNMYDPPMDVVAARDHITHLVYQLMQPQVL
YESSTLPSTDFPYPMLVLTGPRGCGKRELTHRLCQEFNEYFAYGICHTTRGPYFGEENGL
DYHFVSEEVFQSMIHTGKLIQTIQYGGHSYGLTRDAVENVAREGLACCVHMELEGVVSLK
KSYFEPRYILLIPTQVEKYIGHLKARGLYTQAQMDAAVSRIELYANTNRQRPGFFDNVIP
CDDWEDAYKTLRQAVKEYLLLEEQEEASLADPKCHNASFLKQDTDCKARALDPSDISYRS
YFTKIQEELHPQKSSTELASIRRREQLVREAIVGKSPGVYSQLFKR
Download sequence
Identical sequences I3K0H3
ENSONIP00000014618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]