SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014823 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014823
Domain Number 1 Region: 4-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.01e-58
Family Ankyrin repeat 0.000028
Further Details:      
 
Domain Number 2 Region: 477-529
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000107
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014823   Gene: ENSONIG00000011775   Transcript: ENSONIT00000014835
Sequence length 537
Comment pep:known_by_projection scaffold:Orenil1.0:GL831167.1:4400515:4404497:1 gene:ENSONIG00000011775 transcript:ENSONIT00000014835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISAGDVDALQELSGCASAFRESDSRGWLPLHAAAVQLQPDVLHTVLQVLESTDLTLEEQT
EDGDTALTLAAEAGQVENIKLLLKHGASPHNTNSRNESPLLIAVRQRSYEMVLSLIMGGA
FVEQVCLTKWRAIHEAAKEGCAAILMLLLRHGAKITSRDGHGVTPLGIAAEHGNTEVLDI
LIHHGGDVNAQASNGDTVLYDATGSGNLDCVKLLLEHGANPNVASYACQLPIHRAAYEGY
ILILRTLIPITTKRAIRLSGQSPVHSAADGGQVQCLELLIQKGYDVNALLHAHISENYGD
LRKTPLYFAVSNGDVTCSERLLAAGARTDLDPLRCILVAIRAERYDLVELLLSHGAEVNC
YFRVISNTVFPTALQYCFRDHVMLRMLLNSGYHAYKCFQCGHGDGEELDSTWTELHNQAY
QIYSQPKVISFCEFVSVSCLAHVVGKVVRMLLDYVSHVSICFKLRQILQRRPEWDEISDI
LGKPRSLQHLCRLVIRSHMSLRTLNDPETMAAGPFPPRLMNYLTYREYDLYGDLLSV
Download sequence
Identical sequences I3K128
ENSONIP00000014823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]