SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014910 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014910
Domain Number 1 Region: 443-689
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.66e-88
Family ABC transporter ATPase domain-like 0.000000758
Further Details:      
 
Domain Number 2 Region: 1104-1350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-85
Family ABC transporter ATPase domain-like 0.00000144
Further Details:      
 
Domain Number 3 Region: 778-1094
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.96e-62
Family ABC transporter transmembrane region 0.001
Further Details:      
 
Domain Number 4 Region: 60-109,170-434
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 8.89e-60
Family ABC transporter transmembrane region 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014910   Gene: ENSONIG00000011842   Transcript: ENSONIT00000014922
Sequence length 1356
Comment pep:known scaffold:Orenil1.0:GL831144.1:575274:600694:-1 gene:ENSONIG00000011842 transcript:ENSONIT00000014922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTGSVKLQSIKHLGQENHSYEVSDEEPTGSYITITHSKKGEKAQKNEEQPAIRVGFFEL
FRFATCKDIQMMVVGCVCALLHGSAQPLMLLVFGLLTDTFIEYDIELQELSDDRKECVNN
TIQWKKNYTAAYNLSAPVNQSDIGLLNSTLEMFVPLENRTCGLLDIEYEMMMFAFYYVGI
GAAVFLLGYLQISLWVTAAAKQIQLIRKLYFSKVMRMEIGWFDCTSVGELNTRMSDDINK
INDAIADQVSIFVQRFTTFVCGFCVGFVKGWKLTLVIIAASPLIGVGAGLMALFVAKLTG
MELQAYAKAGSVADEVLSSIRTVAAFGGEKKEVQRYDRNLVSAQRWGIRKGLIMGFFTGF
MWLVIFLCYGLAFWYGSSLVVDTKEYTPGTLLQVFFGVLIAAMNLGQASPCLEAFASGRG
AATIIFETIDREPEIDCLSEAGYKLDRVKGDIEFHNVTFHYPSRPEVKILDQLNVVVKSG
ETTAFVGPSGAGKSTAIQLIQRFYDPKEGMVTLDGHDIRGLNIQWLRSLIGIVEQEPVLF
ATTIAENIRYGRPGVSDKDIITAAKEANAYNFIMDLPQKFDTLVGEGGGQMSGGQKQRIA
IARALVRNPRILLLDMATSALDNESEAVVQEALDKVRLGRTTISIAHRLSTIKNADVIVG
FEHGRAVERGKHNELLERKGVYFTLVTLQSQGDKALNEKARQMADHEDEPERLKLSRAGS
YRDSLRASIRQRSRSQLSNLIPEASVPTGDISISQPDNYKNAFLEEDDELVEPAPVARIL
KYNAPEWPYMLFGSIGAAVNGGVNPVYSLLFSQILATFSIQDPVAQRKEINSICLFFVVV
GIVSFFTQLLQGYAFSKSGELLTRRLRRLGFQAMLGQEVGWFDDHRNSPGALTTRLATDA
SQVQGATGSQIGMIVNSLANIGVALIISFYFSWKLTLLILCFLPFIALSGGFQASMLTGF
AKQDKEAMEAAGQISGEALNNIRTIAGLGKEKTFVEMYEAQLDAPYQAALKKANIYGACY
GFSQCIIFLTNSASYRFGGYLVQKEGLHFSLVFRVISAIVTSGTALGRASSYTPDYAKAK
ISAARFFQLLDRVPQISVYNDKGEKWDNFQGNIEFIECKFTYPSRPDIQVLNGLNVSVKP
GQTLAFVGSSGCGKSTSVQLLERFYDPDHGKVLIDGHDTTRVNVSFLRSKIGIVSQEPIL
FDCSIAENIKYGDNLREISMNEVISAAKKAQLHDFVMALPEKYDTNVGSQGSQLSRGQKQ
RIAIARAIIRDPKILLLDEATSALDTESEKTVQEALDKARQGRTCIVIAHRLSTIQNSDI
IAVMSRGIVIEKGTHDQLMALKGAYYKLVTTGAPIS
Download sequence
Identical sequences I3K1B5
ENSONIP00000014910 XP_005449990.1.78416 XP_019207698.1.78416 ENSONIP00000014910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]