SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014948 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014948
Domain Number 1 Region: 85-140,189-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000491
Family PAPS sulfotransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014948   Gene: ENSONIG00000011874   Transcript: ENSONIT00000014960
Sequence length 422
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:715901:735498:-1 gene:ENSONIG00000011874 transcript:ENSONIT00000014960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKFNRLIFIPIAAVLFLMIGYQYVCPADSNTCYFRSDEKGLFQRYSPGLELVYTEPEA
DEDLPSKITSRFNFTERELDRRVDFNIRGDDVMVFLHIQKTGGTTFGRHLVKNIQLEQPC
DCMAGQRKCTCHRPGKAESWLFSRFSTGWSCGLHADWTELTSCVPVVMNKRDKKNTPKSK
SLFLCKLQTYKFRRGSNNRRLIVTSSPILADRNTSESDTNFYYITMLRDPVSRYLSEWKH
VQRGATWKTALHMCDGRPPTQDELPACYSGEDWTGVPLPDFMNCPSNLANNRQVRMLADL
SLVGCYNMSSMSELERGRVLLASAKSNLRNMAFFGLTEFQRKTQYLFERTFGLRFIRPFT
QINSTRAASVGINEKVRWRIEGLNALDVELYEYAKELFLRRYQYNRQRQHQEERLRRRQE
RQ
Download sequence
Identical sequences I3K1F3
ENSONIP00000014948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]