SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014960 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014960
Domain Number 1 Region: 1035-1277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-67
Family ABC transporter ATPase domain-like 0.000026
Further Details:      
 
Domain Number 2 Region: 709-1025
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 6.15e-60
Family ABC transporter transmembrane region 0.003
Further Details:      
 
Domain Number 3 Region: 408-632
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.52e-55
Family ABC transporter ATPase domain-like 0.00000427
Further Details:      
 
Domain Number 4 Region: 85-391
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 5.1e-40
Family ABC transporter transmembrane region 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014960   Gene: ENSONIG00000011884   Transcript: ENSONIT00000014972
Sequence length 1322
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:841732:880899:1 gene:ENSONIG00000011884 transcript:ENSONIT00000014972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVSKDAKTNPAATANFLSKIFFWWLNPLFRAGYKRRLEEDDMYQVLAEDRSEKLGQDL
QRIWDHEVQRATKELRKPQLTGVIVKCYWKAYAVLGIFTLIEETIKVVQPILLGKIIEYF
ESYDPNNTRAFHETLGYAAGLSLCTIGLALMHHLYFYYVQRVGMKIRVAMCHMIYKKALH
LSSSAMGKTTTGQIVNLLSNDVNKFDEVTIFLHFLWVGPLQAAAVIGLLWYEIGPSCLGG
IGVLLILMPVQSMFGRLFSKFRSKTAALTDSRIRTMNEVVSGMRIIKMYAWEKPFAALVS
EVRRKEISKIMKSSYLRGLNMASFFCASKLILFVTFTLYVLLGNTISASSVFVTVSLYSA
VRLTVTLFFPSAIEKLFESRVSVRRIQEFLTLDEIRKNTVGLPQDEKDAAVEIQDLTCYW
DKSLDAPSLQSISLTLNSNQLLAVIGPVGAGKSSLLSSILGELPAEKGVLRVKGQLTYAA
QQPWVFPGTIRSNILFGKELNPQKYERVIRACALKRDLELLPDGDQTLIGDRGATLSGGQ
KARVNLARAVYQDADIYILDDPLSAVDAEVGRHLFEQCICGLLKNKLRILVTHQLQYLKA
ADQIVVLKEGHMVAKGTYTELQQSGLDFTSLLKKEEEEEQQQPHHDTPIRTRTLSQNSVL
SQTSSVQSIKDGDQLPAEPVQTFAEENRAQGTIGMRIYAKYLTAGANIVVLLAVVLLNIM
AQVAYIMQDWWLAYWADEQEKLMASSNMTNNTENGLNVTKELDMDFYLGIYGGLTAATII
FGFGRNLLLFSVLVRCSQSLHNRMFSAILQTPVRFFDINPIGRVLNRFSKDIGLLDSNMP
VTFADFVQIFLQILGVIAVAASVIPWILIPVVPLLLIFLYLRRYFLRTSRNVKRLESTTR
SPVFSHLSSSLQGLWTIRAFGEEERFQKVFDAHQDLHSEAWFLFLTTSRWFAVRLDGICS
VFVTITTFGCLLLRDKLDAGAVGLALSYSVTLMGMFQWGVRQSAEVENMMTSVERVVEYT
KLESEAPWETQKRPPPDWPSKGLVTFDQVNFSYSADGPQVLHNLKAMFRPQEKVGIVGRT
GAGKSSLVSALFRLAEPQGKIYIDGLVTSEIGLHDLRQKMSIIPQDPVLFTGSMRKNLDP
FNQHTDEELWSALEEVQLKSVVEELPGKLETALAESGSNFSVGQRQLVCLARAILRKNRI
LIIDEATANVDPRTDELIQKTIRDKFRECTVLTIAHRLNTIVDSDRILVLDAGKIHAYDE
PYTLLQDPTNIFYKMVQQTGKQEAAALLEAAKKAYDSRSRPGLSNGHAVTADGNLVIFET
AL
Download sequence
Identical sequences I3K1G5
ENSONIP00000014960 XP_003440940.1.78416 ENSONIP00000014960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]