SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015063 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015063
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.56e-57
Family Ankyrin repeat 0.0000939
Further Details:      
 
Domain Number 2 Region: 236-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000353
Family SOCS box-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015063   Gene: ENSONIG00000011963   Transcript: ENSONIT00000015076
Sequence length 280
Comment pep:known_by_projection scaffold:Orenil1.0:GL831213.1:316823:321480:1 gene:ENSONIG00000011963 transcript:ENSONIT00000015076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEKSRPYFFGDIGCWAERTEVHKAASLGQASQLEELIQGGASVNMVAVDSITPLHEAC
LHGQAKCVQLLLEAGAQVDARNVDGSTPLCDACSAGSLECVRLLLQYGAKANPALTSRTA
SPLHEACMGGNSECVKLLISMGACLEAYDLYYGTPLHVACANEHTHCVKELLNAGAKVNA
TRLHETPLHHAAKSMRVETIEMLVEFGANIYARDQHERRPVDYTTPGSPSAACLQSYETS
PLSLQQLSRLAVRRKLGTRALNVIGQLEIPKLIISYLCYQ
Download sequence
Identical sequences I3K1R8
ENSONIP00000015063 ENSONIP00000015063 XP_003449797.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]