SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015092 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000015092
Domain Number - Region: 109-174,201-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00773
Family PAPS sulfotransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015092   Gene: ENSONIG00000011989   Transcript: ENSONIT00000015105
Sequence length 320
Comment pep:known_by_projection scaffold:Orenil1.0:GL831213.1:698082:721583:1 gene:ENSONIG00000011989 transcript:ENSONIT00000015105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWSIICFPVMRRNPFMVEGCCRKGSRNALQELYNPTQPELSGAAVLHQARRDQVVDACRV
YSASSRKRRVLTPGDLKHLVVDEDHELIYCYVPKVACTNWKRVMMVLTGRGKYSDPMEIP
SNEAHIPSNLKTLNQYSIAEINHRLKNYLKFLFVREPFERLVSAYRNKFTLKYNSSFHKR
FGTRIIRRYRKNATQDALLNGADVKFKEFIEYLVDPATQRDGLNEHWQTVYQLCHPCHIH
YDMVGKYETLEEDANYLLQLVGVGDSLRFPTYAKSTRTTDAMTAQFFSNISTQQQIQLYQ
LYKLDFLMFNYSIPSYLRLQ
Download sequence
Identical sequences I3K1U7
ENSONIP00000015092 ENSONIP00000015092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]