SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015124 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015124
Domain Number 1 Region: 24-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-46
Family G proteins 0.000000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015124   Gene: ENSONIG00000012015   Transcript: ENSONIT00000015137
Sequence length 243
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:1923055:1938141:-1 gene:ENSONIG00000012015 transcript:ENSONIT00000015137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKERRPCQKLSLKSSMDPSQSVKCKIVVVGDSQCGKTALLHVFAKDCFPESYVPTVFENY
TASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVMKKWKGE
IQEFCPNTKMLLVGCKSDLRTDLSTLVELSNHRQAPVSYDQGSSMAKQISAPYIECSAQQ
SENSVRDIFHVATLACINKNNKNVKRSKTARASKRISHMPGRPDLAAVASDLRKDKAKSC
SVM
Download sequence
Identical sequences I3K1X9
ENSONIP00000015124 XP_003440900.1.78416 XP_005739925.1.53837 XP_005933977.1.24487 ENSONIP00000015124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]