SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015226 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015226
Domain Number 1 Region: 490-801
Classification Level Classification E-value
Superfamily RNI-like 3.92e-59
Family 28-residue LRR 0.0000306
Further Details:      
 
Domain Number 2 Region: 811-990
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-45
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000015226
Domain Number - Region: 71-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000164
Family Nucleotide and nucleoside kinases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015226   Gene: ENSONIG00000012096   Transcript: ENSONIT00000015239
Sequence length 991
Comment pep:known_by_projection scaffold:Orenil1.0:GL831213.1:2460359:2478214:1 gene:ENSONIG00000012096 transcript:ENSONIT00000015239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKEKYQNIYEGNADEGETVYLKKIYTELHMIEGAWGSFSDEHEVRQQRSTLVSGDEKSTK
AINIFKPKPNQNKRIRTVLTLGIPGMGKTVCAQKFTLSWAEGEENQDITLLFPLPFREIN
TTIGEKDYSLMQLIHQFFPETKPLEKLGANCKVLFIFDGLDETLLPLNFKHNKVLRDETE
PAPLDVLITNLITGDLLGNALIWITSRPAAAHRIPRKHIHQWTEVKGFGNAQREEYFKRS
LHDDSLALRVINHVKSSRSLYIMCQIPVFCWITVTVMKKMVRKNMTGVIPNTLTEMYAYL
LICQTDRMVEGHYPLKSNNVLLKLAELAFRQLEKGRSIFYEADLKECGIHVKEATIYSGV
CTEIFVMEGGNRREVFSFVHLTIQEFLAAVYAHYLYMKRKENVFLGYLKRIYTRWQFKSV
FNFHKTAIEKALESTDGHWDLFLRFLLGLSLKSNQELLCKILDLDVEGEEDVSRTIQFIK
EKISEEADANLNLFHCLSELKEEALVQEVQSFVSSGRLDAKKMSSAQWSALTFELMTSET
TEEEFDLKKYIKSEEGMVKLLTVITSSKHALLNHCNLTENCCEALASVLSSTSSHLTALD
LSGNKLKDSGVKLLSAGLRSPHCKLKSLRLNQCKLREGCCGNLASLLKSGSSRLKTLDLS
NNSLKDSGVSLLAAGLRNPQCRLETLRLSWCNLSQKCCEPIGSAISSDSTQLKELDLSGN
DLQDSEIKLLSNGLANTSCTLKTLRLTFCGVTEVGCTHLTSALSSNSYQLRELDLSYNYL
QDSGIKLISVHGDKLEKLSVDPNAECFLKATLKNYACTLTFDKSTASKSLFLHDGGKQVT
WVRERQQHPDHPERFETVSQVLCQQGLTQHHYWEVEWRGRWVDVAVAKRGISRRAGYHLS
GFGYTDQSWSLYCSDDHYTAQHDGHNVEILGHPSHSHRIGIFLDWPAGTLSFYSVFSGTL
KHIHTFYSNFTEPLYPGFGMEEDDCSVIICK
Download sequence
Identical sequences I3K281
ENSONIP00000015226 ENSONIP00000015226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]