SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015246 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015246
Domain Number 1 Region: 9-300
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.54e-80
Family Protein kinases, catalytic subunit 0.00000576
Further Details:      
 
Domain Number 2 Region: 744-931
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-49
Family Nucleotide and nucleoside kinases 0.0000000819
Further Details:      
 
Domain Number 3 Region: 620-734
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-32
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 471-568
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 336-389
Classification Level Classification E-value
Superfamily L27 domain 7.65e-20
Family L27 domain 0.0001
Further Details:      
 
Domain Number 6 Region: 400-450
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000129
Family L27 domain 0.0000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015246   Gene: ENSONIG00000012112   Transcript: ENSONIT00000015259
Sequence length 935
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:5990496:6041847:-1 gene:ENSONIG00000012112 transcript:ENSONIT00000015259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMADDDVLFEDVYELCEVIGKGPFSVVRRCINRDTGQQFAVKIVDVASFTSSPGLSTED
LKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVA
SHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG
RVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEAIIKGKYKMN
PRQWAHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKF
NARRKLKGAVLAAVSSHKFNSYYGDPPEELHDFSDDPTSSGAVSQVLDSLEEIHALTDCS
EKDMDFLHSVFQDQHLHTLLDLYDKINTRSSPQIRNPPSDGVQRAKEVLETISCYPENME
AKELRRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPDSTNGDMDLEN
VTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINGISV
ANQTVEQLQKMLREMRGSITFKIVPSYRSQSMSCEKESPDLSRQSPANGHASVTSSILDL
PSTIQPKGRQICRPAIKDKLSIKIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISK
DDHNWWQGKLENTKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDK
YLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPI
PHTTRPPKKDEENGKNYYFVSHEQMMQDISNNDYLEYGSHEDAMYGTRLETIRQIHAQGM
ISILDVEPQALKILRTAEFAPYVVFIAAPTITPGMTEDESLQRLQKESEMLQQTYAHYFD
QTIINNEIDDTIRLLEEAVDLVSTTPQWVPVSWVY
Download sequence
Identical sequences I3K2A1
ENSONIP00000015246 ENSONIP00000015246 XP_005450082.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]