SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015331 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015331
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-31
Family G proteins 0.00000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015331   Gene: ENSONIG00000012171   Transcript: ENSONIT00000015344
Sequence length 185
Comment pep:novel scaffold:Orenil1.0:GL831144.1:6548263:6562228:-1 gene:ENSONIG00000012171 transcript:ENSONIT00000015344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIRNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRGTSRYRWCWWATRWT
WRMRGRCLPARARRWLRIGAAPSWRRQPRARPWWMSFSRRSSGRWTSALCRTGERPAAPP
VAYSS
Download sequence
Identical sequences I3K2I6
ENSONIP00000015331 ENSONIP00000015331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]