SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015356 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015356
Domain Number 1 Region: 318-465,517-927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-224
Family Nitrogenase iron protein-like 0.000000000124
Further Details:      
 
Domain Number 2 Region: 127-292
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.24e-52
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000036
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 9.02e-38
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015356   Gene: ENSONIG00000012191   Transcript: ENSONIT00000015369
Sequence length 934
Comment pep:known_by_projection scaffold:Orenil1.0:GL831192.1:1483309:1501240:-1 gene:ENSONIG00000012191 transcript:ENSONIT00000015369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAQIISGKEVSAQVRERLKEDVEQMKLKNPNFRPGLVVLQVGDRDDSNLYISMKLKAAA
EIGINAMHMRLPTTATEEEILHSITEVNENSSVHGLIVQLPLDSVHEINTEKITNAVAPE
KDVDGLTSINAGKLSRGDLGDCFIPCTPNGCMELIKQTGVSVAGKRAVVIGRSKIVGAPM
HDLLLWNHATVTTCHSKTADLAAEVGRADILVVGIGKAEMVKGEWIKKGAVVIDCGINHV
IDDSKSSGKRVVGDVHFQSAKEQAGFITPVPGGVGPMTVAMLMANTVLSAKRFLESHQAG
KWNISYTALNLQKPVPSDIVISRSCAAKSIDSLAREVGLLSDEVELYGKTKAKVQLTIIK
RLQSRPDGKYVVVTGITPTPLGEGKSTTTIGLAQAMGAHMKLNVFACVRQPSQGPTFGIK
GGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDARIFHEATQSDKALYNRLVP
LSGRERKFSPIQINRLKKLGIEKTEPSALTEEEINHFARLDIDPSSVTWQRVLDTNDRFL
RKITIGQSPTEKGYTREAQFDITVASEIMAVLALTSSLEDMRQRLAKMVVATSRRGDPIT
TEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSILADKIALKLVGP
EGFVVTEAGFGADIGMEKFFNIKCRYSGLRPHVVVLVATIRALKMHGGGPTVTAGMPLPK
EYVEENLNLLEKGCNNMRKQIENAKHFGVPVVVAVNAFKTDTDAELDLVCTMAKAAGAFD
AVRCSHWAEGGAGAVALGEAVQKASSAPSNFKFLYDLDLPIADKIRIIAQKIYGADDIEL
LAEAQHKVALYTKQGFANLPICMAKTHLSLSHEAEKKGVPKGFILPIRDIRASVGAGFLF
PLVGTMPTIPGLPTRPCFYDIDLDPETEQVNGLF
Download sequence
Identical sequences I3K2L1
ENSONIP00000015356 XP_003447800.1.78416 ENSONIP00000015356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]