SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015508 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015508
Domain Number 1 Region: 707-880
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-51
Family SPRY domain 0.00036
Further Details:      
 
Domain Number 2 Region: 495-693
Classification Level Classification E-value
Superfamily RNI-like 2.26e-31
Family 28-residue LRR 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000015508
Domain Number - Region: 73-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00518
Family G proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015508   Gene: ENSONIG00000012312   Transcript: ENSONIT00000015521
Sequence length 888
Comment pep:novel scaffold:Orenil1.0:GL831181.1:2873600:2881073:-1 gene:ENSONIG00000012312 transcript:ENSONIT00000015521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSLKSKFQCLFEGTAKTRNPTFLNDIYTELYITEEGTGEVSNEHEVRQIETAVRKPARP
ERTITCEEIFKASSGKDQPCRTVLTKGVAGIGKTVLTQKFTLDWAEDKANQDIQFTFPFT
FRELNLLKGTNFSLVKLVHHFFTEAKEAGLCSLEELQVVFIFDGLDECRLPLDFQNNKIL
TDTRQPTSMDVLLTNLICGNLLPSARLWITTRPAAANQIPPGYIDMVTEVRGFTDLQKEE
YFRKRFGEEEQASRIISHIKTSRSLYIMCHIPVFCWITATVLEDVLKTRAGGELPKTLTE
MYIYFLVVQAKLWSIKYHIGAEAEPHWNPGSREMVLSLGKLAYEQLQKGHLIFYESDLTE
SGIDFRVASVYSGLFTQIFKEERGLHQEKVFCFVHLSVQEFLAALYVFLTLTNFGVNLFQ
DKSKLSYLFQIAVDMAVQSPNGHLDLFLRFLLGLSLPTNLTLLGGLMTQTGNISLDKQET
IEYIKSVIRRSLSTERSINLFHCLNELNDHSLVEEIQQYLNSGSLSTDKLSPAQWSALVF
ILLSSEEDLDMFNLKKYCASDEGLLRLLPVVKASNKSLLSGCNLTERCCEGLASVFSAQS
STLRDVDLTNNNLQDSGLKLVSSGLKNPQCRLEKLRLSGCLITADGCTSLASALRSNPSY
LKELDLSYNHPGESGVKLLSVGLKDPNWRLDSLSEDHGGLQRLKSGLRKYACELTLDPNT
AHKNVVLFENNRKVRLSPEKQPYPEHPDRFDWCYQLLCTMGLTGRCYWEVEWKGGVDIGA
TYRSVRRRGALDGSRLGWNEKSWNLEFTDKNIYAWHNNIKTALLAPPTSASQRVGVYLDW
TEGTLAFYAVLPDSQIHLYTFFCGAFTEPLYPGFGFLSIDSSVSLLEI
Download sequence
Identical sequences I3K313
ENSONIP00000015508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]