SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015509 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015509
Domain Number 1 Region: 11-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-31
Family G proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015509   Gene: ENSONIG00000012313   Transcript: ENSONIT00000015522
Sequence length 298
Comment pep:novel scaffold:Orenil1.0:GL831181.1:2982154:2984022:-1 gene:ENSONIG00000012313 transcript:ENSONIT00000015522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTAVNDEEQESPECLRIFLIGKTGSGKSSTGNTILGKKLFKAMSSQHSVTKHCQKEESEV
DGRPVAVVDGPGLFDTTLSNEEVHEEMVKCVSLLAPGPHVFLLVFRIGRFTDEEKTTLKL
IKEGFGENSEKFTIILLTRGDELERDERSIEEYIEQDCDDLFKKLLSDCGGRYHVFDNVG
KENHQQVSELIAKIDTMVKENGGKYFTNEMLQEAEAAIKKEMERILKEKEEEMKRMEREE
RKKEQEIREKENRKREEEERMFKKEKEKKKPVLYSMNQHFVIMTVIHMEKKKQKQQKK
Download sequence
Identical sequences I3K314
ENSONIP00000015509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]