SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015540 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015540
Domain Number 1 Region: 712-886
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-50
Family SPRY domain 0.00077
Further Details:      
 
Domain Number 2 Region: 501-713
Classification Level Classification E-value
Superfamily RNI-like 5.3e-26
Family 28-residue LRR 0.00089
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000015540
Domain Number - Region: 72-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00117
Family Nitrogenase iron protein-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015540   Gene: ENSONIG00000012334   Transcript: ENSONIT00000015553
Sequence length 894
Comment pep:novel scaffold:Orenil1.0:GL831256.1:801591:804900:1 gene:ENSONIG00000012334 transcript:ENSONIT00000015553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFEYIYEGTVRHGDQTLLNKVYTELYITEGLSENVNNEHEVRQIEAASRRSMTKDKQIKC
EDIFHSLCGSDRFIRTVLTTGIAGIGKTISVQKFNLEWAEGRVNQDIQLLINLPFRELNL
MKERRYTLTELLHIFLTEAKESGISDFSKYKLVLIFDGLDECRLPLDFNNNEPCSCVSDQ
VSVDVLLTNLFKGNLLPSAHIWITTRPAAARRIPVNCVDRVTEIRGFNDPQKEEYFRKKI
SDQNMASRVISHVQSTRSLHIMCHIPVFSWISATVLQKILEEKSHESRGEMPNTLTKMYT
HFLVHNSLIKCQKYSLREEVCETQSQVKMNEEMILKLGKLAFEQLLKGNIIFYENEISEY
EINVSDTAVYSGVFTEISKNDFGIHLKRSYCFVHLSIQEYFAAVYVFHTFICSNLNLLEP
EGSLTVQEASSEVTGLLQSAVDKALQSENGQLDLFLRFLLGLSHESDQLKSILATMRSTL
PNNEEVTEYIKEKISQNLSPERCINLFHCLSELNDQSLVEEIQKCLSSGSLSEITLSPSL
WSALVFVLLTSKDELNEFDLRKYSRSEEGLQRLLPVINSLLTLQNILACGNLTEKCCEML
STVLFSSCLKELDLSDNDLQDKGVKLLLDGLGNTACQLEKLSLAFCGITDSGCDSLAKAL
TSSLKHLKELDLSYNDPGELGMKHLSSIEKDPDHLTIRYRISDSGECYLKSALKKYAQEL
TVNMNTAHSELSFSDDKKKMKLMVESQQYPDNPERFEDWGQVLCNEGLRDRCYWEIEWSG
EWMGIGVAYKGISRKGKGNEPVLGYNDQSWSLRYCKGKYTVWHNKNDDAPISVPYFNSKR
VGVFLDWPAGTLSFYAVSSQTMIHLHTFHTEFTEPLYPGFRLGEPHATLILRQP
Download sequence
Identical sequences I3K345
ENSONIP00000015540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]