SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015746 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015746
Domain Number 1 Region: 28-372
Classification Level Classification E-value
Superfamily L domain-like 1.53e-68
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 393-527
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000016
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 647-707
Classification Level Classification E-value
Superfamily Polo-box domain 0.000051
Family Swapped Polo-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015746   Gene: ENSONIG00000012507   Transcript: ENSONIT00000015761
Sequence length 994
Comment pep:known_by_projection scaffold:Orenil1.0:GL831271.1:366386:387706:1 gene:ENSONIG00000012507 transcript:ENSONIT00000015761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMEDKENNLKTARLWRDAALRSRKLRSNLRQLTLCSKNNQIILPEDIADIEALNLGNNS
LQELPDGLGSSLNNLRVLVLRRNKFSSVPRVVFELGRLVELDMSHNCLRSLPEGVGQLRG
LKKLCISHNKIQHLPAQIGALQSLEELDMSFNDLHDFPRSFSGLARLRTLDADHNKLNQF
PPEIMALGELEELDCSGNKFEVLPADVWKLQSIKILWLSSLHMSSLPHTFCHLQHLESLM
LDGNHLTELPPSFGNLQSLKMINLSSNDFENFPQVILSIMGLEELYLSRNRLIHIPEEIG
QLGKLVNLWLDNNSITYLPDSIVELENLEELVLQGNQIAILPDNFGKLSKVNIWKVKDNP
LIQPPYEVCMKGIPYIAVYQKELAHSQFAVKPRLKLVLMGTQNAGKTRLRQSLVSTQQDA
SSNQGNKGIEVTNWVADADRHLTFLVYDLSGKQNYDLIKPFFLSPGALYILVINLKTYSP
KNFYTHVGYFLHLLCAKVPHAVVCLVGTHTDLCAEVEVEEKTLDIHRQIGLQEKRDIQSL
RGLALQVDQALEQGYNVRTSSPHVLFYGVTDKNLRRRKAQLQYMLNHRLQILSPVLRVSS
TGAQRNIPRLREKLMSVAEHREIFPNLHRVLPKSWQMLEELHFKPKDLWLSWWDSARLGL
QAGLTEDRLQSALSYLHESGKLLYFEDSLTLKEYVFHNLPRFIAILNVFFQRDESTLLDR
LLSEDEKGENLRVTHLQHHVEGFLQHGLLPSNVIRLLLRPLIQTQQDLHLIMELLEKMGI
CYCINKPRSKPLNGATVWYKFPSYVSSEEVQVDASAGGSSLPLCNFFSVEQLHIQYSFPF
LFPPGLFARFSVQINSHVVQRSDSKHQIFAYRGKVPVVISHRPAKGKLQVETLSIASHAS
LPNIWTAWQAITPLVEELNMLLQEWPGLHYSVHVLCSKCLKRGSSNPHAFPGELLSQPRP
EGLTEIVCPKNGSERVNVALVYPPTPTVLSPCLK
Download sequence
Identical sequences I3K3Q1
ENSONIP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]