SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015825 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015825
Domain Number 1 Region: 57-654
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-55
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015825   Gene: ENSONIG00000012572   Transcript: ENSONIT00000015840
Sequence length 817
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:474193:486321:-1 gene:ENSONIG00000012572 transcript:ENSONIT00000015840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSPMAAKPSTASASQLRPSTALDSLSVSSLLSGDLDDEEDGGSRGGEDEGLGDLEVNP
YDGLPFSSRYYALLEERQRFPVWRLRQSLLEHLESHNMVLLSAPSGSGKSTQVPQWCVEY
ALSYEFSHGLVCCSQPHSVAAVSLALRVADEMDLSLGLEVGYRVPNDDGCTPDTMLRFVS
DTLLLEEMMSDPLLHQYGVVVLDELQERTVPTDVLLGLLCDVCRQRPDNFRVVLLTHPTL
APRLATFLGPSIPHLSLDNLPSEPANGDQEEEEEGGAVKRKTVNVEVETLYRELSAGKEP
TAVACHMVLDLHRRGEEGDVMVFLANAQEIEECAALLEKECVALSPQLGALRLLPLHAGL
GGLTQRIYESDPDASALREDGGSEDNSAVGAGGVGIKRKVILTDALAEASFSLPGIRYVI
DMGLQLKNVYNPQIRANSQVLRTISKHQADMRTQRVNSHLPGLCLRLYSQSLYEEGMAEA
HSPGVMEENLSHLVLLLKRLDIADMGQCKFLDRPAPEALMQALEDLDYLAALDDDGNLSE
VGIIMSELPLEPSLAKALIAACEYDCVDELLTIAAMLTAPSCFVTAEPSREEAAVTHWRP
LMHTEGDHMTLINIYNAFLEHNQDEAWCMTNFLCHAALRLAVVIRAQLLEVMQRIELPVS
PPAFGCQDNCTNIKRALISGFFLKVAHDVDGSGNYLLLTHRHVAHLHPFSSYLCRQPRPD
PPSWVLYHEFTISRDNCIRIASDVHPQMFVELAPQYFLGNLPSSDGKELLMELRQSLEPP
GLYDQEGATQEHDRSPRDAEGGQEPHNQSSTELCAIQ
Download sequence
Identical sequences I3K3Y0
ENSONIP00000015825 ENSONIP00000015825 XP_005470614.1.78416 XP_019216910.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]