SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015826 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015826
Domain Number 1 Region: 9-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-54
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015826   Gene: ENSONIG00000012572   Transcript: ENSONIT00000015841
Sequence length 731
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:475781:484114:-1 gene:ENSONIG00000012572 transcript:ENSONIT00000015841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEGLGDLEVNPYDGLPFSSRYYALLEERQRFPVWRLRQSLLEHLESHNMVLLSAPSGSG
KSTQVPQWCVEYALSYEFSHGLVCCSQPHSVAAVSLALRVADEMDLSLGLEVGYRVPNDD
GCTPDTMLRFVSDTLLLEEMMSDPLLHQYGVVVLDELQERTVPTDVLLGLLCDVCRQRPD
NFRVVLLTHPTLAPRLATFLGPSIPHLSLDNLPSEPANGELSAGKEPTAVACHMVLDLHR
RGEEGDVMVFLANAQEIEECAALLEKECVALSPQLGALRLLPLHAGLGGLTQRIYESDPD
ASALRKRKVILTDALAEASFSLPGIRYVIDMGLQLKNVYNPQIRANSQVLRTISKHQADM
RTQRVNSHLPDKLFCSLCLRLYSQSLYEEGMAEAHSPGVMEENLSHLVLLLKRLDIADMG
QCKFLDRPAPEALMQALEDLDYLAALDDDGNLSEVGIIMSELPLEPSLAKALIAACEYDC
VDELLTIAAMLTAPSCFVTAEPSREEAAVTHWRPLMHTEGDHMTLINIYNAFLEHNQDEA
WCMTNFLCHAALRLAVVIRAQLLEVMQRIELPVSPPAFGCQDNCTNIKRALISGFFLKVA
HDVDGSGNYLLLTHRHVAHLHPFSSYLCRQPRPDPPSWVLYHEFTISRDNCIRIASDVHP
QMFVELAPQYFLGNLPSSDGKELLMELRQSLEPPGLYDQEGATQEHDRSPRDAEGGQEPH
NQSSTELCAIQ
Download sequence
Identical sequences I3K3Y1
ENSONIP00000015826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]