SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016015 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016015
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-55
Family G proteins 0.0000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016015   Gene: ENSONIG00000012725   Transcript: ENSONIT00000016030
Sequence length 218
Comment pep:known_by_projection scaffold:Orenil1.0:GL831141.1:3018247:3079726:-1 gene:ENSONIG00000012725 transcript:ENSONIT00000016030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGDYDFLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTASNPNG
TTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQA
NAYCENPDIVLVGNKADLADQREVQERQAKELAEKYGIPYFETSAATGADVDKAVLTLLD
LVMKRMEQCVDKPPAEPANGNGATKLGDAQPIAKKCTC
Download sequence
Identical sequences I3K4H0
ENSONIP00000016015 ENSONIP00000016015 XP_005470538.1.78416 XP_005470539.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]