SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016021 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016021
Domain Number 1 Region: 70-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-68
Family Tandem AAA-ATPase domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016021
Domain Number - Region: 320-455
Classification Level Classification E-value
Superfamily SSO1389-like 0.0288
Family Cas DxTHG 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016021   Gene: ENSONIG00000012731   Transcript: ENSONIT00000016036
Sequence length 477
Comment pep:known_by_projection scaffold:Orenil1.0:GL831204.1:3153290:3160001:-1 gene:ENSONIG00000012731 transcript:ENSONIT00000016036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDFSSLGLSDWLVKQCKQLGINKPTPVQENCMPAILQGRDCMGCAKTGSGKTAAFVLPV
LQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQALELSNQ
PHVVVATPGRLADHIRSSNTFSMKRIQFLILDEADRLLEQGCTDFTKDLEVILEILPAKR
QTLLFSATLTDTLQELKSIAMNKPFFWESKSETRTVEELDQRYILTPEKVKDAYLVHLIQ
TFTDEHDDWSIIIFTNTCKSCQILTMMLREFNFPTISLHSMMKQKQRFANLAKFKASVYK
ILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLI
HSIEEQIQTKLKEYPVVEKEVLKILTQVNVTRRECEIKLESTDFDEKREINKRKQLILEG
KDPELEAKRKAELEKIRSQKKKFKQKIQESIQKQKQLKKKLMKRRQMKKKEAAQATA
Download sequence
Identical sequences I3K4H6
ENSONIP00000016021 XP_005454090.1.78416 ENSONIP00000016021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]