SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016069 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016069
Domain Number 1 Region: 797-974
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-49
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 611-802
Classification Level Classification E-value
Superfamily RNI-like 7.85e-35
Family 28-residue LRR 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016069
Domain Number - Region: 99-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00201
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016069   Gene: ENSONIG00000012764   Transcript: ENSONIT00000016084
Sequence length 980
Comment pep:novel scaffold:Orenil1.0:GL831790.1:30338:90115:-1 gene:ENSONIG00000012764 transcript:ENSONIT00000016084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEELANQLQSNSFFLERNLKSALKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTA
EINKEHEVRQIETASRKPDRPETTIRQEDIFKASPGRDEPIRTVLTKGVAGIGKTVLTQK
YTLDWAEDKANQDIQFIFPFTFRELNLLKEEKFSLVELVHHFFTETKEAGICSFEDFQVV
FIFDGLDECRLPLDFHKTTILTDPRKSNSVDVLLINLIRGKLLPSARLWITTRPAAANQI
PPDCVDMVTEVRGFTDPQKEEYFRKRFGDEEQASRIISHIKTSRSLHIMCHIPVFCWITA
TVLEDVLETREGGQLPKTLTEMYIHFLVVQAKLKKVKYDGGAEADPHWNKKNRKMIKSLA
KLAFDQLQKGKLIFYDSDLTECGIDIRAASVYSGVFTQIFKEERGLYQDKVFCFIHLSVQ
EFLAALHVHRTFINSGLNLLEEQQITSKKSKLFNKPILQTLHQSAVNKALQIPNGHLDLF
LRFLLGLSLQTNQTLLRXAASGQSLQQSSSPELFQWVKVNIKGRTGVRRVINMLFYMLLN
HLKLQFIVLYVNYIMLNYLTAVLLSSKLFETLLFCTLGPEEETETLCRGFNVSSQALDAV
SAVAQHSFKERLVDCDLSEISCDYLAAALKSNPSYPTVLDLSSNYNNLQDSGVKQLCFLL
ENPRCRFETLRLSHSDLSERSCEALSSGLSFQSSNLRQLDLSNINLKDSGVRLLSLGLKS
SHCTLETLSLSGCLITEEGCTSLASALSSNPSHLRELDLSYNHPGDSGMKLLSAGLKDPG
WRLDTLRVEPPGVQWLRPGLRKYSCQLTIDSNTVHTNLQLSDNNRKVTRVEEVQSYPDHP
DRFDGWWQLLCRNGLTGRCYWEVDWRGYVYISVSYRRTRRKGGSDDCLFGWNDHSWSLYC
SDEGPRCVWHNNRSTSISSSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFNTTF
TQTLYPGFMFWSPGSSVSLC
Download sequence
Identical sequences I3K4M4
ENSONIP00000016069 ENSONIP00000016069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]