SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016293 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016293
Domain Number 1 Region: 929-1198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-69
Family Tandem AAA-ATPase domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 680-927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.6e-54
Family Tandem AAA-ATPase domain 0.0000695
Further Details:      
 
Domain Number 3 Region: 431-478,505-551
Classification Level Classification E-value
Superfamily Chromo domain-like 6.41e-18
Family Chromo domain 0.017
Further Details:      
 
Domain Number 4 Region: 308-381
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.51e-17
Family PHD domain 0.002
Further Details:      
 
Domain Number 5 Region: 575-644
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000175
Family Chromo domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016293
Domain Number - Region: 149-187
Classification Level Classification E-value
Superfamily HMG-box 0.037
Family HMG-box 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016293   Gene: ENSONIG00000012953   Transcript: ENSONIT00000016308
Sequence length 1907
Comment pep:known_by_projection scaffold:Orenil1.0:GL831225.1:1174566:1197051:-1 gene:ENSONIG00000012953 transcript:ENSONIT00000016308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPSPTEEQEPEDAVSDVDEVPKSKKKKKAKKSSRENRSSKRQRPIREELPVSSPEHLLG
VEAAERDADEGGMRSESEGSDYAPGRKKKKRSSSAKDKKNSKSKRKDPEPEDDEDDDDDC
QPKSSTQLLEAWGMKDIDHVFTQEDYSSLTNYKAFSQFVRPLIAAKNPKIAVSKMMTLMM
AKWREFSTNNPLKGCATANAALAAANVAAAVENMVVAAPIAPPAAPAPPLRKAKTKEGKG
PNARRRSKPTSKPPPKPKPKKVAPLKIKLGGLNSKRKRSSSDEDEPDVDSDFDDGSFSVS
DGSSRSSRPKKKPKSAKKKKKVETEDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMV
CLDPDMEKAPEGKWSCPHCEKEGIQWEARDDLSEAEGEDDDDRRDEGMEEEDDHHIEFCR
VCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWICPRCKCPPMKGKVQKVLTWRWGEA
PAPMPVPRPADLPADAPDPPPLAGRREREFFVKWCNMSYWHCSWVQELQLELNCQVMFRN
YQRKTDMDEPPPADFGGEGDDDKSTKRKNKDPLFVHMEEEFCRYGVKMEWLMIHRVLNHS
VDKKNNVHYLIKWRDLPYDQSTWESEDMDIPEYDTYKQTYWNHRELMMGEEGRPGKKLKK
TVKVKKAERPPANPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQATDTILA
DEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYIGDK
DSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACL
VVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGF
LEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSSMQKKYYKFIL
TRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAANEAPKLPNGMYEGTSLTKASG
KLMLLQKMMRRLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNLRQEAID
RFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVM
IYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKMGSMSKQELDDILKFGTEELFKDE
VGDVSGDNKEDDSSVIHYDDQAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQYVVKDED
DEEEEVEREVIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRTRKPVNYNDGSQED
RDWQEDQSDNQSDYSVASEEGDEDFDERTEANARRPNRKGLRNDRDKPLPPLLARVGGNI
EVLGFNARQRKAFLNAVMRYGMPPQDAFTNQWLVRDLRGKSEKEFKAYVSLFMRHLCEPG
ADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWSMPWMAELEENKRAA
ALAAGEDPKTPSTGTPADTQPNTPVPVHITEDLSKSEDKEDMKKEGEDGKAAKKADDPEI
IEIPDESEKSPVLDKKEEADSAAEKEDREKETDGVEGKEKEAEDMSKEKEEKSVEKDASA
EIKGEGSESKMDLVENFFLFLEQKEEKDSVKPDESGKLQNGENAKDGGTAAPVVNVSEEK
KKATKQRFMFNIADGGFTELHSLWQNEERAATVTKKTFEIWHRRHDYWLLAGIIQHGYAR
WQDVQNDVRFAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMT
EDPAHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADV
TRLPATIARIPPVAVRLQMSERNILSRLASRGPEVTAQNQSQTAQQM
Download sequence
Identical sequences I3K598
ENSONIP00000016293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]