SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016372 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016372
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000869
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016372
Domain Number - Region: 724-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0885
Family Nitrogenase iron protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016372   Gene: ENSONIG00000013017   Transcript: ENSONIT00000016387
Sequence length 1576
Comment pep:novel scaffold:Orenil1.0:GL831189.1:3245297:3250099:-1 gene:ENSONIG00000013017 transcript:ENSONIT00000016387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KENYLRLPLLIEDWTKEHVKDWLVITLKVPNHIAQSLYDQEMSGACLASFEKQDLVDLGV
PPAPAIQIIKQVEKLMKPSGTSDSSATTKRSHCISENIAETETVSSDSGIQSQSSVVQML
QTARDRIRSVIDQNTWIDTQPPVEIADNTAALQIRRPTCQIRPFDEHSSTFYTENYVLPP
SAGPSNLLDPVHEYQLLPSASEASEREILYEFTKEVFSFAASCMNSRTNGTIHFGVNNQQ
GPQHGQVIGHLITSSIKYTEAFKSSVSEYFEEQYVNAAKMCIRFPNFIQVCYGNGTSTDK
WVIEVDVIPTFSETQENLFYTLLNIDTAEKNQQCKTECLFVRDGPRSFNILADTNPRVVQ
EKIKRLTEEVKHLASARKLAEEKNEKCQPQGHQGQRLKQLISRGKDSFENSLQVIVVTDK
CHSTQLEHLDFLSELKLFAVLEFDPESDINGTCSFYRRDHIANLHYPHMYTTHDSLTATI
GKLNLFKQTSWIFCNGKVNEDSETNKPLTTSEWIKKRSGEITQMISVLCNPDLLSKDRLL
VIFILHSAVTDISSPILETFCAMYRTLEGADNMMCICKDSTVFIQWKKLIADRCKEDLTS
KCIYELSLNEISSTIKKFRQPQTQSSQRYLPSTGSSSVQLIRKDEELFTALDILSENECE
NTEIETNDSFQEFKKKTEEDFYRGGQVTWWNFYLSEQTGSLPFVKRDKYNELFDLITPVQ
GYKLPCVVINLFHHPGCGGTTLAMHVLWNLRRKFRCAVVKNNMESNKEIAAQVMNLVIYG
KQEQPGYVPVLLLVDNWEDVEDLKQCILNVASNRKQHNSCMVIILNCERTQFPEKSSRNT
HFENVFITNKLSTKEQILFSEKLEQLKIDHEKPETFYAFMIMTNNFSETYITDLVSNTVK
DLDTTNQQGQLLSFLALLNTYVNGSYMSLSLCEALVGIKDALWKQETLDDKMNPYSTLLI
TFTVEEHGTYQAVRFLHQMIASKCLKVLNQKHKLSLSEITINILHCDRVYKSCMGKDFLI
QNIQSMLITRHRKEQGDDKDTLFSPLIEEIYADEGPDKTKQVLERATVRFDRSATLPQAL
ARHFYLKEEDFISALRWALDAQSKKPNSYIADTVGQVYKSHLKKKIKDSLTPEEFDECLR
LGVKAVKAFQESQELAKTDEQVDPFDLHSRKRPKSYNTSGYVGETEVMMILFDIIKDLPL
SGVSGRHKRDKMLQFLKGHLEEKNLYDHSNTTANEFVTVLAEHKKFLISLRPRLKEIFSF
FENYFTYLKPRSKEREMADERNKRKVSEYFRKYMQVFSSSDEEKASEKARNPNLSLSQEL
LDQKYYLETKRADTFAGLLQCLIDKHGTEMEHIVKKWKFIYENSSSVSETVSFILANIVL
HSIKPSSKLLKKYEELVELLNEELQKEGTHSNLTELYYLSMLLLWPTKDKKLESLEAHRN
ISTYVTSAKKSFHRRFSYMFPARSTIAHFFLGKSSGLKRVVSKAKLDQIVARASKQDSTY
SDSGAAWNYPEVQRELLRIKGKSENGELYVNYGANLKILVRPVYLGDIRSGYSQEEVSFY
LGFTMEGPVAYNIKYV
Download sequence
Identical sequences I3K5H7
ENSONIP00000016372 ENSONIP00000016372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]