SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016440 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016440
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily Bromodomain 6.41e-41
Family Bromodomain 0.00028
Further Details:      
 
Domain Number 2 Region: 256-378
Classification Level Classification E-value
Superfamily Bromodomain 2.62e-39
Family Bromodomain 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016440
Domain Number - Region: 457-575
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0942
Family Formin homology 2 domain (FH2 domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016440   Gene: ENSONIG00000013072   Transcript: ENSONIT00000016455
Sequence length 621
Comment pep:novel scaffold:Orenil1.0:GL831141.1:6253912:6258586:-1 gene:ENSONIG00000013072 transcript:ENSONIT00000016455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAATMSADTNQDPPQLVNPPPPEVTNPNKPGRRTNQLQYMQNIVIKSLWRHQFAWPFYQP
VDAVALGLPDYHKIITSPMDMGTIKKRLENNYYWSASECLQDFNTMFTNCYIYNKPTDDI
VLMALALEKIYLQKVAQMPQSEVEIVPHAAKGKGKKSSTPGNSLKRTCNTDYLLEVNEYF
DVRSHEFSRLHRLAHDAEPLVCNAVTKYEMRGCRRSWRVMGFTVTLQNPGNPDFQFHRKK
RESSSRAKSDFEEESSQQNTEPCGLSEQLKYCNHILKEMLSKKHSAYAWPFYKPVDAEAL
QLHDYHDIIKYPMDLSTVKKKMDAGEYQDAQAFAADVRLIFSNCYKYNPAHHDVVIKARK
LQGIFEQRFAKMPDEHVEVTSQAGGSLEKPESAEERTTRLAELQEQLKAVHGQLAALSEA
PVSKPKKKKENDKKDNSRQNVGVMNSRCTSNSCARYSWKGSNEWESEDESLPMTYDEKHQ
LSLDINRLPGMKLGHVVHIIQSREPSVCNTNPDEIEIDFETLKPSTLRALEQYVKSCLCK
KFKKFQSKYQAQTHLNSFDIKAQITHRFSHLIDDAASFTPLHPEKSRQTPSHRTTTTSSS
SSSSSSSDSANTSFTDSSTED
Download sequence
Identical sequences I3K5P5
ENSONIP00000016440 ENSONIP00000016440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]