SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016479 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016479
Domain Number 1 Region: 1427-1712
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000105
Family Nucleotide and nucleoside kinases 0.087
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016479
Domain Number - Region: 1050-1119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000256
Family ABC transporter ATPase domain-like 0.079
Further Details:      
 
Domain Number - Region: 2056-2108
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0371
Family TauD/TfdA-like 0.048
Further Details:      
 
Domain Number - Region: 1853-1941
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0948
Family Extended AAA-ATPase domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016479   Gene: ENSONIG00000013102   Transcript: ENSONIT00000016494
Sequence length 3309
Comment pep:known_by_projection scaffold:Orenil1.0:GL831536.1:274945:290868:-1 gene:ENSONIG00000013102 transcript:ENSONIT00000016494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPLLKEADDLVCRHHPSMAKALDTMFSFLFCDLKNIVSDSTSGPFLDPGQNAKEMMSKLN
YMCMHVNTLSAKLELLSRSSQEMGEHTIDLTVLTTDVQKAVARKDLWELVAVYTTWLEEW
KPMLFSEVVVSEAQDKIAKWKEQAQSLTTTIPASDAVLQEILGSLENISHQLLVLAKLQS
PTLKEKHWRAILEDLGLKYKSEKNVTVADLMSQQFESHQNLIDKVCRCAQRECDMKQTFQ
KLCHRWEGEALVIVSIIFEIPSGCPAWRKCVSGIFSLRVAYICFVFPHSDLGVYFAEIEN
SLMMLSTMLKSPYSVEFRLPLEHWIQTLQELEQLLALLERYQQMWAFLTNMLGGTFFHTQ
RMDLLKHFQPVDETFEIMMTSISNEPRVLNLVSTETNGRFCGDSLCQVLLNGLSAMEVIS
KQMSDLLDDLCEECPRFWFLSEGEVMQILSLDPTPFEFQPFVQKCFKGVHLLEVDCEIRR
DGDSISECQRQMKVMGVFGSLQEHVAFQSPLEPNADALKWFCNFEKELKLTMVQLLTQCA
VVRKQLELSSQNFPSDTKARDNQLPSAVAVLGLLSEYPLQSLLVVEKAMWCSVVLQAFQE
SSSVKFSTIKAHISAKLKDLSHYIRDGVTGSKSGTQVSKYTMMCLRALLQLTMDHAEQLH
RLMDVPCARESSFEWLSCMKYYINSEENNDPTCFVDILGHQIQYSFEYSGPEEWEMVHTP
CTDRAILGILIALTTYRCCSVGGPSMSGKKNTVIQLGKALGRQVVLKQCYPSMMPRVIQR
MLVGALQAGAWLVLNSVDLLTHSDLSILGQHLVDIQQSFNMLRRNKKERLNCETEINIPD
GVAGFTNARKHISASLSYGCVAISSKGNISRVPESLRFATRSVALTRPDYRIMAEVMLTS
IGFSDAMSLSQRLVSLISLAQESHCLPDLFSDNHSCFLVILQKIMEDGRKTEKPPKSHRC
YLTVVQSLMEEEAIVRAILSVLLPEKKGTSQFYILFKDAFPIACQFPLVQQFIEEAEKNQ
LEDALREELQQKHFCCDTDIICNALTLYQTMKLSQAVMLIGPPGSGKSTCYTALTGALNS
LAAKTDWSFVDTLVLFPNAMSHDEIFGCFCEKRGWIDGALAKVLRDAGRREHASFKLCNN
EKKTDETVMVKWLVMDGEPVGKPGWLDFLTMLCSSQDGFLGLSSGETLLSQSKLKLLMEV
TDLCNASPSAVTRCSLLYVTGDDLWKSVWKSEIDALSFKYKLDDRIVKMWNHLAEDLFSS
TLHLLGQRSLTSAIHTERKSCKAPTYGLQEVMSFVRILHALLQHFGKEVEKPESVAHIDT
RGKITSHKYMPPAATGAQSKQEQLSRNIFLLAYIWGFGGRLHSRHWPQFDLLARQVLLTC
RYKIVVPDEVSVYEHFFSIDTKMCPKNTLSTGSVIPMYRKYTYLLNLMLEAKQPVLVSGE
PGSGKTTLCQTVLTFDKPHINLPASPLLSSRDFHTILKSIRCQKNCKETTGFMANQPRLF
LFVDDLHEALCDVFGTSAMALETLRQSISKGEILTFDTYSSKLLQSGTISYLAACCISGL
DHSHSGVISPRLSRLFSVFVLDGVSPDILMSIYSPWLKIWLNEMPLNRHIGEDMPSCIVT
ATNELYHAVSDRFQPSVQRPHFIFSHRDLQKVFQGMYLWSSVISNKENKKVSQPGFAPAS
VLNIVQVWMHECMRTFSDRLCSEKDRKTVVSLIAKTAATHYGMKVANEIDGDSQPAGENT
DPVDLPKGVNQQSQLHSALTKPENIRQQPQILQHLEDTMARLAFGPDLSEALKSIKEQQY
FKFSPSYQEQDLDTLVQKLCVLTDGKEEGEGPDRSITTKYIVHRQRVSQLLHIIRALLLP
RGHGVLIGSDRGTGRKTTVCLAAHLTGYELLEIHAGNENNLHEILKEAGNQTRSDGINVI
ILVHEEISQSVREELLVLMAHGACPARYTEEELRARLSPHNSPKTDLNTFANVCKHLNQQ
RRLSQVHRNIHVFLLMPYSMSESTDIPSKNEAQSWVVKVYQPWSNQSLVEVAVQCLKTSA
CKMVRESSEASLSVAMAGIHQSAYQYASVLLRNQPFSPRTYMEFIAHFGYLCSHLHKQCQ
DKANRIAAAGSRLDAVNNTSMQRKEHLISVQKMVSETEQCEKELLQAVEDHKKLFEEAFE
KCAAEEQQLCYLEEQINQAQKQIKPAFLSGLQILKCLDPSDVEEVRHYRDPPVGVVQVMD
AICLLFSHPPGWESAKQLLSQADFFQELEYFDRYNLTNEQLQQLGQIVHSPQFVPEAVRE
VSKACESLCRWVQAVYEYCCVQQRVLLKQQLEVQAAETRSRLNQAEQRKQEAYSSLEAIE
LHLQCVQNDLMEQLMLLHEAESAEREASACAGQCETYGEVWRAAAQDTELRNQSVPGDAL
LLAAIISYLGPFGPDIRTELLRKWRTLCQTGSININPNDPRTSLFTQLDTVSGSSSLGFP
IPVTERLQLPLGQALGMNEWQTEDTLSARLVVKLLLCGYRSTYIQHWPLLADSQQHLEMK
FKNRLIPGMCRHLQNVLRHGPHRTSEDWMSQDLEHFWDIHQSMSMLKEAIGKTVAMKGRA
WCKQCLSLHREARDSTGLLPSFSSICCHLIPRWMVICGDDVELVHKLDQAAEKGLRVLVT
HVERAIPSPQFLAKLSRPAGCYFPGLNQPIKMVHPEFCLFLSTCLPIRLLNSGIHPSILA
QIRVVDLSLSSEDIPELMLTQLPQPECKELLIQHLQFQNYKQELQEKLATEEDALMGYIL
QSNTVLLQDPDFLPRVKVCQEVTKKLQDEMKQLREQLEHHESLLAVPRHLVRLGAALYQT
LQAVSSLSPAYYFSLHGFITVMQEAFTGKDRIVGKVPGSIIQELINTMVVKVLVQYRPCL
FKTHAAVLKLLVSLALLQHNQLCSEGERLAFLIGLGDTQHPGTDSPSSIADLPSWISPLI
HSELLRLEKIPSFRGLIASLCASPKQWQEYLHFPSSTVLGPVPCRSHCHLSLLQRALLWK
TMIPDCLEGLADAINACQLCLPQKKAETEAPLIGNPEAFSLYLVKHKEPIILTLPNPNRD
MQTSVEPLCLINQLAKCVPGKKEVQVKVLSFWALCDRNLFLSMLDKAANDGHWLVFNNSH
LLEQLDDEVVAKLSHVISSVKVFMFVDASAYLCASSYYTEKPCLSHPCFRLWFITQENTS
HLIPGALTHFVSPMLFFQCVILAGVVEVASISQPQSAVMADNKSLLRCAIFHSVLVQRQT
YKYLGQGRIYHWSQEDLHALVDAYIHVAHLCHDKTKVLQYLAVSLVYGGHVTDSADLEVL
ENIAETCFT
Download sequence
Identical sequences I3K5T4
ENSONIP00000016479 ENSONIP00000016479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]