SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016632 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016632
Domain Number 1 Region: 107-227,293-525,645-675
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-98
Family Motor proteins 0.00000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016632   Gene: ENSONIG00000013226   Transcript: ENSONIT00000016647
Sequence length 1044
Comment pep:known_by_projection scaffold:Orenil1.0:GL831355.1:109349:123467:1 gene:ENSONIG00000013226 transcript:ENSONIT00000016647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKITLNLSKYSLPDFRTCLFDPELVTELGGGEDGGGTSAAEYCDWLEHLIFGRTFTRG
KFSNREEALLRTAERVFTTQTMQRPGKGKTPRRPGPKKASNTERDPVGVYCRIRPLGSED
EECCVEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGINTTQLELFEDVAKPLVED
LIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMIFNSIGPFQAKRFVFKPDDKN
AMEIQSQVDALLERQKRDSQQAVPKTPSSRQKPDPEFADMISPDEACKSENVDEDGCYSV
FVSYIEIYNNYIYDLLEDAPYDPIRPKPPQSKILREDQNHNMYVAGCTEVEVKSTEEAFE
VFWKGQKKRRIANTQLNRESSRSHSVFTIKLAQAPLDADGDHILQDKNQVNVSQLCLVDL
AGSERTNRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFK
NYFDGEGKVRMIVCVNPNADDYEETVLVMRFAEMTQEVEVARPVDRPICGLAPGRRHRNQ
AFRDELSRRLEERGGPSNAVDDRVLMTQFIESLPDLPTCELVDPADDQTLPRLIEVLERR
HQIRQMMTEQFNKTANTVKSMLQQFDSQLSAKDYFLHDQQSKLNEKDKVILSQKTEIERL
EKKSKTLEYKIDILQKTTDMYEQDKRALQQELETREQRLQSELSERKRMEQRMQGVVTDT
KLKWEKECERRVNAKQLEMQNKLWVKDEKLKQLKAIVTESSSGGSAPTERPEKPERPSRE
RDRNIQQKRSPSPLPDFSQTPSHQNKARVRVFQDPTSTPSSSDYPSVASSISRWEQRFPV
DSDSQNRFTGTPQCRSRTPAPCHSTSSVGHRRGQRRAPGTEVPATTLVYGLDLEAGTRKA
LPVHPKHRRSHSAGGEKWVDHKPPSNLELDTVMQPIIPNAIKVSTPSEKALSKCHKYVLR
HQELASDGEIETKLIKGNVFKTRSGGQTVQFTDIETLKQECPLAPSRKRRSGSAEGPAEV
EDIENRAPVASTNSSHGYQKRRKP
Download sequence
Identical sequences I3K687
ENSONIP00000016632 ENSONIP00000016632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]