SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016753 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016753
Domain Number 1 Region: 451-590,623-723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-60
Family Extended AAA-ATPase domain 0.00000378
Further Details:      
 
Domain Number 2 Region: 192-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.36e-59
Family Extended AAA-ATPase domain 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016753   Gene: ENSONIG00000013321   Transcript: ENSONIT00000016768
Sequence length 748
Comment pep:known_by_projection scaffold:Orenil1.0:GL831355.1:902999:908662:-1 gene:ENSONIG00000013321 transcript:ENSONIT00000016768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLRLLSVDPSDRGSQRCRLGPGMMSALGVHLGSPLLVSVPGGSCLCTAWPRADLAEGF
LQMDLKCFSPSLLSQLPSHLSLDPAQVSPVICSKLKGVRITVIVQSVNFRKRTPHRLVHE
LVKDMLKGVCVHDGFVINLEDFDTEIKYVVIESISPESDSAGFITSKTAVEIAGIQTLRH
YRSQLQDRHTVQLGGLEEVSASLREMLKLPLLYPSTLSSLGVSCPRGVLLVGPPGVGKTL
LVRQVVGEVGACLVVVRGPEVVGARPGESEEALRAVFERARSAADEGPCVLFLDELDSLC
PRRTSSSAPENRLVAQLLTLMDGMNQSDRFLIVGATNRPDSLDPALRRPGRFDREVIIGA
PTLQQRKAILSVLCERMPVCPSVNLTELAQTTTGYVGADLSALCREAAMHAIREDSKCSG
EQLVSMKHFHEALKSVRPSCLRSSMGRTELSPVTWEQIGGLDDVKLKLSQSIEWPMAHPE
AFVRLGLCRPRGVLLYGPPGCAKTTLVKAAATSSNCAFLSVSGADLYSPYVGDSEKALAQ
LFHQARACAPSILFLDEIDSLIGSRSHSQTPNSVQTRLLSVLLNEMDGIGLKTHERRGTE
KILQAEGVEESHTPEQLDCQEVCNKDVMVVAATNRPDCLDSALLRPGRLDHIIYVPPPDQ
EARLAVLKVCTKCMPVGADVRLEDLAAKTELFSGADLENLCKEAALLALLDGNMEASDIK
HTHFLRSLSKMSSSLTEQQINKYETPPR
Download sequence
Identical sequences I3K6K8
ENSONIP00000016753 ENSONIP00000016753 XP_005461634.1.78416 XP_005461635.1.78416 XP_019220545.1.78416 XP_019220792.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]