SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016857 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016857
Domain Number 1 Region: 322-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-29
Family PAPS sulfotransferase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016857   Gene: ENSONIG00000013409   Transcript: ENSONIT00000016872
Sequence length 567
Comment pep:known_by_projection scaffold:Orenil1.0:GL831238.1:1295243:1312455:1 gene:ENSONIG00000013409 transcript:ENSONIT00000016872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPLLKIQRYFRRKPVRFFSLILLYLTAGSLVFLHAGFVGDNGPGARGGRDSLIASEMG
SWASSDTRGLGLMSRVFKEKRRSGRRFGPPWMKKTRQEGQGMVGRGRDYTSNWKRALKGR
NAKDLDDGRAKYIGCYIDDTQKRALRGVSFFDYKKMTVFRCQDNCAERGYMYAGLEFGAE
CYCGHKIQAPNVSESECNMECKGEKSNVCGGPNRLSIYRLELSQESARRYGSAIFKGCFH
RPDNVTLALPFSAVIQNMSVDKCVDMCTEREKSLAVLAGDRCYCGFPTPLFSLHELEDEG
MCLNRCQAEEFESCGNDKYFVVYQTQVQDNRCMDRHFLPTRAKQLVALASFPGAGNTWAR
HLIELATGFYTGSYYFDGSLYNKGFKGERDHWRSGRTICIKTHESGRKEIEAFDSSVLMI
RNPYKALMAEFNRKYGGHIGFASQAHWRGKEWPEFVKNYAPWWASHTLDWLHYGRNVHVV
HFEDLKRDLFSKLKGMVEFLGLKVSEDRLLCVEGQKDGNFKRSGLRKLEYDPYTPEMRSN
INELIRTVDAALKKRNMSGVPEEYMPR
Download sequence
Identical sequences I3K6W2
XP_003451691.1.78416 XP_005473397.1.78416 XP_005473398.1.78416 XP_005473399.1.78416 ENSONIP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]