SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016976 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016976
Domain Number 1 Region: 320-458,533-586,626-719
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-44
Family Tandem AAA-ATPase domain 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016976
Domain Number - Region: 1162-1202
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0183
Family Sigma4 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016976   Gene: ENSONIG00000013500   Transcript: ENSONIT00000016991
Sequence length 1235
Comment pep:known_by_projection scaffold:Orenil1.0:GL831186.1:117033:134984:-1 gene:ENSONIG00000013500 transcript:ENSONIT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLNVPPPGPMDLPMSLLEMGCSGRFELITHPVPGQPLPPQSTLPHGLPPTNLNLETEV
EKQFLRDPAWLPIHDKDFAFQKFLKVTQRKVDVDSLLNCCPSPLHSGLSVVRDPTTGMLL
DFTEVLLENTGLSAKNSLSLQRQPGPPSESLRGSNTNYPFLPGGMEELTLEQIKKKSELE
EEIDFESDLLKVAPGLKAGMDFTDKDAKIAKPEVNLMSLLSTVEGISGLQLEAEEKEKDK
ESEDAPKLPRTNSLEDLGIKDAASSSSPPEKENTEENKKWAIPVNITSPCDDFYKRIPNP
AFKQWPFELDVFQKQAVLRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPI
KALSNQKFRDFKNTFGDVGLLTGDVQLSPESSCLIMTTEILRSMLYNGSEVIRDLEWVIF
DEVHYINDAERGVVWEEVLIMLPDHVSIILLSATVPNALEFSEWIGRIKKRHIYVISTLK
RPVPLEHYLYTGNSTKTQKEMFLLLDATGNFLTKGYYTAVDAKKERTSKHAQSFGTKNTS
QNTTASQDRSVWLTLLHFLSQRQQTPVVAFTFSRTRCDDNARSLDSMDLTTSIEKAEIHS
FFQKSLTRLRGGDRQLPQILLMRDLLKRGIAVHHSGILPILKEVIEMLFSRGLVKVLFAT
ETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAG
VHEMADLHAMMLGKPTLLQSQFRLTYTMILNLLRVEALHVTDMMRRSFSESHRDTQTHEK
RISQLKQMLSAMPSVDTEGQLSDLLPYYHTVTELKKTREAVQHAILESVNGLKALSVGRV
IVVNNKQHLNALGVILQVSSDSVNRTFTALIICEKGNEEGKGNDNAALPHLHNMSLFIPE
GPCSHTVQKLKLQDISAITVKTLKVIPERIIDNYNKRQQPRFKLDPPGQAISTATQELLR
LAEANPSGIATLDPVNDLQLKSVDVVEANMRLRVLQESLRDFNCIHSPMFAEFARIKERM
SLQEELDQLLFLVSDQSLTLLPEYHQRIKVLQSLQYIDNGGAVQLKGRVACQISSHELLL
TELLFENVLSPLAPEESAALLSCLVFTQNTQVEPHITNTLQEGIERVKSVAQRIGELQRE
CGIPQTAEEFVGQFKFGLTEVVYCWARGMPFAEIAQLTDVQEGTVVRCIQRLDEVLKEVR
QAARIVGDSVLGSKMEKASLAIRRDIVFTASLYTH
Download sequence
Identical sequences I3K781
ENSONIP00000016976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]