SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017039 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017039
Domain Number 1 Region: 72-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000368
Family PAPS sulfotransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017039   Gene: ENSONIG00000013552   Transcript: ENSONIT00000017054
Sequence length 423
Comment pep:known_by_projection scaffold:Orenil1.0:GL831238.1:1850874:1852396:1 gene:ENSONIG00000013552 transcript:ENSONIT00000017054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKQRIQWRSMCKSLVLGTLLTSCMILVYCLSTPQIHYSLPEVPVPYSCAHRPTQSQHK
STINNSDTAYTCTPKVDIMFMKTHKTASSTFLNILFRFGEKHRVKFAFPDSRNDFFYPSF
FQRSQVKDYRPGMCFNIICNHMRFNAPEVSKLLPVDTSYITILRDPAELFESSFHYFGRL
VPFTWKIPGDDKLAEFLRDPHKYFDPGSFNSYYLKNLLFFDFGLDNSLDVNDPRVEEGIK
FISDRFQLVMLVEHFEESLILLKDALCWEMDDLLFFKLNIRKGSTLSKFTPELRARALEW
NAIDWKLYQHFNQTFWKKVDAYGHQRMAEDVAELKKRNKEMTSICIEGGHAVEAGSIQEK
DMQPWQPIGEKSIMGYNLKKNIDKAHRNLCRKMLMPEIQYLTELGVNLWITKLWGHVRDI
INW
Download sequence
Identical sequences I3K7E4
ENSONIP00000017039 XP_003451712.1.78416 ENSONIP00000017039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]