SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017188 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017188
Domain Number 1 Region: 474-763
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.25e-79
Family Extended AAA-ATPase domain 0.00000000009
Further Details:      
 
Domain Number 2 Region: 202-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-66
Family Extended AAA-ATPase domain 0.000000000764
Further Details:      
 
Domain Number 3 Region: 109-200
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 3.92e-35
Family Cdc48 domain 2-like 0.00000196
Further Details:      
 
Domain Number 4 Region: 24-107
Classification Level Classification E-value
Superfamily ADC-like 1.08e-27
Family Cdc48 N-terminal domain-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017188   Gene: ENSONIG00000013663   Transcript: ENSONIT00000017203
Sequence length 808
Comment pep:known_by_projection scaffold:Orenil1.0:GL831238.1:2137241:2144594:1 gene:ENSONIG00000013663 transcript:ENSONIT00000017203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFALNTSKSKNDDLATAILKQKNRPNRLIVDESINEDNSVVSLSQTKMDELQLFRGDTVL
MKGKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLP
IDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAP
DTVIHCEGEPIRREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPP
RGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAP
AIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALR
RFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEA
ALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFKWALSQSNPSALRETVVEVPNITWED
IGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN
FISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAAD
RVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVSILK
ANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPS
AMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSSAA
GGSGPSHGSGGTGSNPVFNEDNDDDLYG
Download sequence
Identical sequences I3K7U3
ENSONIP00000017188 ENSONIP00000017188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]