SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017267 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017267
Domain Number 1 Region: 587-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-25
Family G proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017267   Gene: ENSONIG00000013725   Transcript: ENSONIT00000017282
Sequence length 861
Comment pep:novel scaffold:Orenil1.0:GL831186.1:2524285:2527317:-1 gene:ENSONIG00000013725 transcript:ENSONIT00000017282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTETETLLERLHLQDKVQQKLSPANFLQIHVPGKHMDHVKSEKDLAHTFLHSLIMLDYRA
RYIAVRPDSPEVTTVSDDTEIDYNDLEYFLKTSADTNDKEREENALVHPMDVQMAVFHCS
DSFLKQMMITKLSQCQYALPLLVPDPVTMEIECPLWTFREITKTWKVTQIKDGSTIITMK
SVPVYKAETPLVSFFRLGSLSVSKSQLMNNLINDRHDTFFHRNFKGNSQSCCLMDGVAEI
AWYCPAGKPNDAFNDCIAFCNLHGDALLTERQRDILIQKSSINIFVFESLPCNEESRSLI
SSHFKSHKPLICLTVDDSRDVVKIKNGKYTIGLKAKNHSDVSEQLKKIIREVLSSLDGPI
LKPSFQLETMAELSGIRVDETDPACQRGKSAAMEIINLLKKDNMDVSKIKDEFLPCQGKL
WHQWSKIHRELFHLRGDIEMEKSIKQQELMNIRQKQCAASCSKLMELFTGSLSSLPPTDR
EYFLKWTQIFIDDLSTDGLSSILQSYDEKWSEVLALKNKHDKADLLLKTQTELDDISKKL
QSATFRLEHIFREMGQIYEAHKTTHRESRHTDWSKYPELAAQLMISGHPMELMDGDVGHV
PLTWISSLLEEVIKKLGDQRVFVLSVLGLQSSGKSTMLNTMFGLQFAVSAGRCTKGAFMQ
LLKVSEEMKKDLKFDYVLVVDTEGLRAHEVEGNNTLHHDNELATFVVGLGNLTLINIFGE
NPSDMQDILQIVVQAFMRMKEIKLSPSCVFVHQNVTDVAAAERNMDGKRRLQEKLDQMAK
LAAEEEVFDAECFSDVIEFDVQKDVKYCAQLWEGSPPMAPPNPGYSESIQEVKNTILSKA
AKKLEFENKLLQKSKELAQKL
Download sequence
Identical sequences I3K822
ENSONIP00000017267 ENSONIP00000017267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]