SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017295 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017295
Domain Number 1 Region: 157-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-68
Family Tandem AAA-ATPase domain 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017295   Gene: ENSONIG00000013748   Transcript: ENSONIT00000017310
Sequence length 487
Comment pep:known_by_projection scaffold:Orenil1.0:GL831186.1:2767632:2773259:-1 gene:ENSONIG00000013748 transcript:ENSONIT00000017310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATARTENVGPVVMGLNKQNGQLRGQTKPAAVQPAPTTQGKTLGAPQKAGGASQDGGGIK
FGDDWKKSLQLPPKDNRVKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESI
PIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQMSQICIQL
SKHLGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVDKVQMMVMDE
ADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPISVQKFMAKHLQKPYEINLMEELTLK
GITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAK
MMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGR
FGHLGLAINLITSEDRFNLKAIEDQLVTDIKPIPSSIDKSLYVAEYHSTSGDCDVEEVEE
KRQQDST
Download sequence
Identical sequences I3K850
ENSONIP00000017295 ENSONIP00000017295 XP_013128042.1.78416 XP_019206445.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]