SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017301 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017301
Domain Number 1 Region: 194-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-109
Family Motor proteins 0.00000000015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017301
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0271
Family Tudor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017301   Gene: ENSONIG00000013754   Transcript: ENSONIT00000017316
Sequence length 702
Comment pep:novel scaffold:Orenil1.0:GL831238.1:2502644:2521053:-1 gene:ENSONIG00000013754 transcript:ENSONIT00000017316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMASGFGKIVVGTYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIF
ALNPDVAPDEEIAPSPETPPPPTPTCVKVNKIAKNRRTIAPPKNDTPSRDNRVWAGSSCL
NQPAQPTQAQTQQQLQNESSHQPLSRKEFGQLSRRKSNCVKEVEKLQEKRERRRLQQQEL
REKRAQEVDTTIPNYEIMYMIRDFRASLDYRPLTTADLIEEHRICVCVRKRPLNKKELSM
KDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSTTNEMVYRFTARPLVET
IFERGMATCFAYGQTGSGKTHTMGGDFSGKKQDCSKGIYALAARDVFLMLKKPSYKKLDL
QVYATFFEIYSGKVFDLLNRKAKLRVLEDGKQQVQVVGLQEKEVKCTEDVLKLIEVGNSC
RYDSRNFLRNXSHAVFQIILRRKGKMHGKFSLIDLAGNERGADTSSADRQTRLEGAEINK
SLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMTSCENTLNT
LRYANRVKELTVDPNQVMEGGRPNIHAVNQLDLLDEEWLSISPQRDDLKLLCEQNEEEVS
PQLFTFHEAVSQLVEMEEQVLEDHRAVFQESIRWLEDEKVLLEMTEEVDYDVESYATQLE
QILDQKIEILTELRDKVKSFRSALQEEEQASKQINPKRPRAL
Download sequence
Identical sequences I3K856
ENSONIP00000017301 ENSONIP00000017301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]