SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017476 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017476
Domain Number 1 Region: 13-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.81e-283
Family Motor proteins 0.00000000000000247
Further Details:      
 
Domain Number 2 Region: 806-906
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000106
Family Motor proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017476   Gene: ENSONIG00000013901   Transcript: ENSONIT00000017491
Sequence length 1853
Comment pep:known_by_projection scaffold:Orenil1.0:GL831403.1:681761:713774:1 gene:ENSONIG00000013901 transcript:ENSONIT00000017491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFSELRNKYTRVWIPDPEDVWKAAEIVKDYKEGDPVLQLKLEDETPLQYPVGPKSNPLP
FLRNPDILVGENDLTALSYLHEPAVLHNLRVRFLESNAIYTYCGIVLVAINPYEQLQIYG
EEVINAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRFF
ATVGGSASDTNVEDKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFNRHYHIIGANMR
TYLLEKSRVVFQAEDERNYHIFYQLCASASLPEFRDLALTSAEDFTYTSLGENIFIEGVN
DAEDFKKTREAFTLLGIKESSQNSIFKVIASILHLGNVEICSDRDGESCHISRKDVHLQH
FCKLLGVELQQMEHWLCHRKLATTSETYVKTMSTKQATNARDALAKHIYARMFDWIVEHI
NLSLQTSIKQHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK
EQIPWTLIDFADNQPCIDLIEARLGILDLLDEECKVPKGTDQNWAQKLYNKHSSSAHFQK
PRMSNISFIIIHFADKVEYQCDGFLEKNRDTVYEEQINILKASQFQLVADLFSDKDDVVP
AKSARVNVRALKTVPKAPNKEHRKTVGHQFRTSLHLLMDTLNATTPHYVRCIKPNDFKEA
FSFDSRRAVQQLRACGVLETIRISAAGYPSRWTYPDFFNRYRVLMKKSDMTTADKKLVCK
NLLETLIKEPDMFQFGKTKIFFRAGQVAYLEKLRTDKFRSACIKIQKTVRGWLQRIRYRK
IRKMAITLQRYGRGYMARRYAEFLRQTRAAIICQKQYRMVRERREFLRVRRAVVTIQAYA
KGMFTRRIYQEFLLHHKAMIIQKNVRGWMQRKKFRRARNAAITIQCAFRRMHAKRQLKQL
KIEARSAEHLKKLNTGMENKIVQLQRKMDDQSKELRTQNEQLQTVNTSLGSEVNKLQKQL
ELLRSQQEDGGQVRSLEEELEHLRKELEEAHALRNKMEEEHINEKMDLTQLLEDVSPLIR
EASSVLNWNLKQAQLEHSVTVQNLIIDEVSSMSLQSELDKERERYQNLLKEFSRLEQRYD
NLKEEMSLNKFQPGHRRNPSNQSSLESDSNYPSVSTSEIGDTEDSIQLVDEMGIDKAAMD
ISLFMKLQKRVRELEQERRKLQLTVEKMEELAKRKGSESRLSTSEQETADLAYNNLKRQE
LESENKKLKNDLNELRKTVAERASQNSSSNELQDSYNLLLSQLKSANEELDARKEEVLIL
RTQIVSAAQLQEKNENILSLNTTETDSSPVVNNSKEPVDKEEALKAYHGLCESKNSNHQD
WCYLNEDGELGLAYQGLKQVARLLEAQLQTQSRQHKDELEALHTQIELLKGDIEDKQEKL
SYMMSLSPEAQVEYSVQQEITRLTNDNLDLKELVEKLEKNERKLKKQLKIYMKKVQELEA
AAQAAVQSSRSKPELIRQVTVQRKEKDFEGMLEYNKEDEALLVKTLINDIRPSNVSGTVP
CLPAYILFMCIRHADYINDDQKVESLLTSTINAIKKVLKKNNDDFEMTSFWLANTSRLLH
CLKQYSGEEAFMTQNTPKQNEHCLKNFDLAEYRQVLSDLSIQIYQQLIKVAEGIIQPMIV
SAMLESESIPSLAGVKPMGYRNRSSSMDTDADGPTSYTLQALIKQLGQFNNIMRDHGLDP
EIIGQVVRQLFHCINAVTLNNLLLRKDVCSWSTGMQLRYNTSQLEEWLRGNNLYQSKAAA
TLEPIIQAAQLLQVKKKTSQDAEAICTLCTALTMQQIVKILNLYTPLNEFEERVTVSFIR
NIQNRLQERNDPPQLLLDTKHTFPVLFPYSPSALSLEMLHFPASLNIDFLVRV
Download sequence
Identical sequences I3K8N1
ENSONIP00000017476 ENSONIP00000017476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]